Posts
 
Reputation
Joined
Last Seen
0 Reputation Points
Unknown Quality Score

No one has voted on any posts yet. Votes from other community members are used to determine a member's reputation amongst their peers.

0 Endorsements
Ranked #4K
~2K People Reached
Favorite Forums
Favorite Tags
Member Avatar for dreadyteddy

Basically need help with one evil section of code! My program opens a start window which introduces the program. A start button leads to a second window with a number of buttons. The main two are "open" and "find restriction site". Im having problem with the code for the latter. …

Member Avatar for dreadyteddy
0
229
Member Avatar for dreadyteddy

I am TRYING to write a program that finds restriction sites in a DNA file and returns a picture and information box of the enzyme which cuts it. My problems are; a) I have no idea if my program works past opening the file directory. b) I dont know how …

Member Avatar for dreadyteddy
0
834
Member Avatar for aint

hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …

Member Avatar for TrustyTony
0
597