112 Topics
|
|
I am trying to return the last value of a list: [CODE] public int GetControllerState() { // return the last controllerState in the list if (controllerStateList != null) { if (controllerStateList.Count > 0) { return (int)controllerStateList[controllerStateList.Count - 1]; } else { return 0; } } else { return 0; } … |
|
I am developing software in which I needed to do more elaborate visual styles to a listbox than usual and I used some sample code online. As a good learning programmer should I tried to understand the code when I edited it and for the most part I did, but … |
|
I have a blog with variety topics of technology information, submitted to blog directory, backlinks site and etc, but unfortunately it's not indexed by google, yahoo index is okay. My blog is about 6 months age. Please help suggest me how to make google index my google! |
|
Hi All, I have two files to compare. Each has 10 columns with first 4 columns being key index together. The rest of the columns have monetary values. I want to read one file into hash; check for the key value availability in file 2; then compare the values in … |
|
I was wondering if someone could help me with a mysql indexing problem. The index of 'username' for this code works fine: [CODE=mysql]EXPLAIN SELECT count( * ) AS num_messages FROM messages, users WHERE messages.username = 'johndoe' AND users.username = 'johndoe' AND messages.sent_date >= users.last_activity[/CODE] Here is the explain: [code] id … |
|
Hi I was wondering if there is any way to created a series of lists in a for-loop so that the first list created is named NAME0 or name_0 or indexed in some way. What I have right now is [CODE]for j in range(int(L)): popsizelocus_j=[][/CODE] however, this is not working … |
|
I am coming from c++ and its nice STL. In C++ I could do this [CODE=C++] <include> string ... ... int nMyInt = 5; string sMyString; sMyString[5] = "b"; [/CODE] Ive tried this approach in c# but doing this way gives me this error [QUOTE]Property or indexer 'string.this[int]' cannot be … |
|
|
I have a complete list of a topics. I have to create a Index for A B C D E ... On Clicking those buttons without navigating to another page it shows only topics wich starts from that letter... How to code it in php??? |
hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] … |
|
I'm just learning VB with the 2008 express edition. I'm trying to create a program that uses 3 list boxes. The first contains a list of products. After a search is preformed the second list box displays the products found. This is pretty simple, basic array stuff. My problem is … |
|
Hello everyone: I'm having a problem with vector indexing. The following code results in a segmentation fault: [CODE] for (int i = 0; i < (rows * rows); i++) { temperature[(i * rows) + (rows - 1)] = 0; }[/CODE] And: [CODE] for (int i = 0; i < (rows … |
|
i want to passing a data from a method but in array.. some error occur like array required but double found and incompatible type.. i don't know how to do it..help me anyone... example: [code]public double getFood(Date date, double AA, double BB, double CC) { }[/code] [code]// below is in … |
|
Hi everyone, I'm currently working on a assignment and have to write a short (max 3 lines) definition on some different kinds of queries. I've written a definition to all of them but I'm having a really hard time about one particular query: Scan Query. I've tried to look in … |
|
Hello all, I'm really struggling to find a way or method to convert my TimeSpan data type into an Int so I can put the value into an Array. Now I know you can't actually convert the TimeSpan variable into Int, but is there some sort of work around? This … |
|
Hi, I am very new to perl pgming. I have a weblog which has a standard format as the below example IP | remoteUser | authUser | Date/Time | Request | Status | Bytes For example, 74.6.72.229 - - [27/Jan/2007:00:00:36 -0500] "GET /~jking/ralph.html HTTP/1.0" 404 215 the fields are seperated … |
|
The scenario is: i have a textbox, a button and a grid view that make up a simple webpage where you can search and edit/delete an entry. the grid view's datasource ID is set to NONE. And this is the code for populating the grid view that is found in … |
|
Hello, I'm confused on how to put the Random.Next() method into my matrix array. First my matrix array is already messed up, I'm trying to create a 6 by 10 matrix of random numbers and then show the numbers times two. here is the code i've already done, ps my … |
|
So, what I'm trying to do is to check if a letter already exists within an array, so I use a for loop and it works very well. So if the character exists within the array, it will not add the letter you put in the input box into the … |
|
I'm developing a 3D Board Game based on the World of Warcraft miniatures board game. I don't know what's wrong ... the game runs and the system is like this I have a model that can move in a map through Cells I made a procedure so you click and … |
|
I am trying to code for an assignment at school. When I call my addElement() method and input the data to pass that data to my constructor which is used to store the data in certain elements in the array it seems to work ok. However, when I try to … |
|
Hi all, I'm creating different pages on a website for each branch in the country for a business. The way the user gets to their branch is through a dreamweaver generated jump menu. My question is: Will search engine robots crawl the pages that are linked via the jump menu? … |
|
pls a little help to a :-/guy, In my main method am working on a collection of numbers in an array. I want to sort the numbers efter then would like to see which index number holds the value 14. As you can see in what i did so far … |
The End.