[text] Forum Topics

I have several strings in a text file and I want to search each string for a word starting with "<" and ending with ">". I then want to replace everything from < to > with a new string. So here's a couple lines I want to convert: [CODE] 400110: …

I have been using Borland Turbo C++ 3.0 to get started with C/C++. I am making a graphics application and this error has come up. I know that my code is too big but I cannot cut it down and I need to add more features. Can someone please tell …

So far I have written a program that draws text to the screen and I am able to change the font type but I am unable to change the font size. Here are the 3 main parts of my code that I think you need to see. Font structure: [CODE]typedef …

Is there a good way to determine the end of a a line in a text file? I need to find of end of a line in text because all text lines are of different length. I also have to store each word (separated by spaces) into a vector. [CODE] …

Hi, can someone tell why or how I can perform a search using text from a drop down box - I can search successfully using a textbox and bring back the correct search results - But when I am using a dropdown box my search seems not to work - …

Hello ppl, i want to know if mysql save some text special chars like the \n i have the nl2br() function to tranform \n in to html <br>, but for BOLD or UNDELINE text ? is there a special char saved in to mysql db ? and is posible to …

I had to write 10 objects of cars into an array and now my problem now is writing the array into a text file. I am able to get the correct output in the console, but when I open the text file I get part of the desired output, as …

I used this pattern few times to answer a thread and thought to post it as snippet.

For this project i need to have the ability to analyze a file containing a number of .NET(3.5) class's from source code.. identify every class and then output each seperate class into their own text file i.e(this is what the file is like, contains a number of class's in it, …

I have a folder in witch i have a sub-folders and in each sub-folder i have text files(.txt). I want to count that text files and want to print the result on the page. Can someone code it out???

I need a php code that will open and show a random text file(something.txt) in the webpage.I found so many scripts that open a random line in one textfile but i need a code in php that will open a random .txt format file in a specific folder to see …

Okay, so I'm having problems with my code. I've browsed Daniweb and couldn't find any solutions on here that work. I'm extracting 2 sets of texts from a .xml file. The first part is a directory name(eg. "C:\work\") and the second part is the name of a file in that …

hi, I have created an application which allows users to view pictures, basically i want to know if it is possible for the file path to be displayed in a text box and for a user to be able to launch the picture using this file name in the text …

I am working on updating a database where some measurements are stored as text. The updates I'm making are to let the engineers that use it convert their measurements into different units. Long story short, the numbers must be kept as text for a couple reasons that I won't go …

I need to keep track of the status for a person who registers for an event. This is going to be part of a tool that is administered by non-programmers. Various events will have different sets of status values, and it is possible for several events with distinct or overlapping …

hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …

I hope this goes here. Alright, so I'm trying to write a simple program that takes the contents of a query's results and pastes them to a text file. Although I could do this manually, I'm trying to create a "user friendly" method for when I'm out of the office …

Hi Everybody, I have succeeded in parsing the values I needed from a text file and storing them in an array. The script I've posted works as a function, but now I tried to put it in a class and I can't figure out how to define the constructor. The …

Hi everyone.. I am a new programmer to OpenGL using C++. I have an nxn grid having numbers in each cell of the grid.. I have to swap the content of two cells.. ie., the numbers in 2 cells selected, have to be swapped. I am not knowing how to …

Hey, i am new to python. I am making a translator in python 2.6 using basic commands. The translator is english to german. I need to use a i need to use a text file like this... at an brown braun cat raze etc. so far i have created lists …

Hey everyone, needing a little hand... i'm using the SDL on windows and all the right libraries are installed correctly, I know this because all my other functions that need these libraries worked and still do, but my SDL_Surface* pFontSurface; variable my print text method creates a compile error. ~The …

Hello, I'm working on a flip page gallery in Flash (AS3). I have this video tutorial from Cartoon Smart and one problem. How to mask a text box, is it possible in Flash using AS3? Cheers!

Hi there, I just try to figure out a function which will dismiss a text and saves it in cookies for next page reload/visit. My current code looks as follow: [CODE]<script src="http://code.jquery.com/jquery-1.4.2.min.js" type="text/javascript"></script> <script src="jquery.cookie.js" type="text/javascript"></script> <script> $(document).ready(function() { $.cookie("viewState"); var theState = $.cookie("viewState"); $("#R1").click( function () { $("#secret").hide("slow"); $.cookie("viewState", …

Hi I have decided to use CSS for layouts. Previously I would have used tables. My problem is that I want to place images to the left and related text on the right of the images. I have used new blank paragraphs to "fill" the space between the end of …

Hi guy, i have this little program: [CODE] #include <stdio.h> #include <stdlib.h> #include <time.h> #include <string.h> #include <unistd.h> //Obtem o nome do buffer de trade baseado na hora char *btfile() { char *fname; fname = malloc(14); time_t t = time(NULL); struct tm *lt; lt = localtime(&t); strftime(fname, 14, "%m%d%H%M.tbf", lt); …

hi, i have some code which is taking a value of how many moves a function is making to an array of numbers, and displaying it but basically, when i call the function initially, it will give the correct number of moves, when i call it again its adding the …

Here is the deal. I am writing a program in assembly that compresses and decompresses text based files. The user should be able to input a text file, and declare the name of what that file should be name when turned into a .drl file (just a random extension for …

Hey guys, I'm kinda new at C++ and need help writing a program that finds email addresses in text files and stores them in an array. The email addresses are then filtered to make sure there are no duplicates. They are then copied to an output file. The program should …

I have just started proggramming in c#. I have created a platformer game and i was wondering if anyone could tell me how to have some text on the screen that shows how many of the collectable "coins" are left. If someone could give me some advice on how to …

Hello all, I have a project in which I need to open an external file which contains to columns of numbers ie: 1000 1000 1111 500 1500 1000 2000 900 2222 2000 2500 2000 3000 1500 3333 2000 3500 2000 4000 600 4444 2500 4500 2000 5000 2500 5500 2222 …