inputbear

Hello, I found this code in a thread from about 18 months ago in a post by 'woooee' - [CODE]def func_1(): print " func_1 test" def func_2(): print " func_2 test" def func_3(): print " func_3 test" def func_4(): print " func_4 test" ##---------------------------------------------------------------- ## dictionary = list of function …

Hey, everybody, I'm a newbie at Python (2.7.1), and new to DaniWeb as well. and the apparent simplicity of Python got me interested in programming (seriously, the only thing before this was HTML). Anyway... I was taking a test and thought that after I was finished I could make an …

Hi DW(DaniWeb) - I hope that's the correct term, since I'm a total Python/DaniWeb noob. I [B]think[/B] Python doesn't have a RE(Runtime Environment), but Python has the option for one. [URL="http://www.python.org/download/"]http://www.python.org/download/[/URL]. So, basically what I want to know is, do you [B]have[/B] to have a RE(Runtime Environment) or anything like …

I've been looking for an exercise book for Python, a book that we get some stuff to code, like ideas, and etc. I have already finished the "Invent your own computer games with Python". Is there any other book? Thanks in advance.

I have this code: [CODE]protein="GWEIQPYVWDECYRVFYEQLNEEHKKIFKGIFDCIRDNSAPNLATLVRVTTNHFTHEQAMMDAVKFSEVLPHKKMHRDFLEKLGGLSAPVDNHIKGTDFKYKGKAKNVDYCKEWLVL" pp="LLCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHCLLLCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCL" gor="cccccccccccchhhhhhhhhhhhhhhhhhhhhhhccccccccceeeeecccccchhhhhhhhhhhcccchhhhhhhhhhhhhccccccccccccccccccccccceeceeccceec" aber="CCCCCCCCCCCCHHHHHHHCCHHHCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC" for i in range(len(protein)): print i+1,protein[i], pp[i], gor[i], aber[i] [/CODE] I'm trying to compare these strings. However, the output is in a vertical format. How can I print it so that the format is vertical? This would make it much easier to …

I am quite new to Python programming, just started about a week ago, and was just designing a simple menu for a simple guessing game. I have browsed Google and other websites trying to find snippets of code that may help me but my searches haven't turned up anything. I've …

It will carry on if the input is X but not O!! block of code concerning this matter [code] print("\nWould you like be X's or O's ? <O/X>:") human=["",""] while not (("X") or ("O")) in human[0]: human[0]=input("") [/code] whole code: [code] print("Welcome to the greatest intelletual challenge of all time: …

Hi, Ive written a program which is capable of sorting an array of ints e.g. array[6] = {4,6,-1,0,6,4} however i want to expand this so it will be able to order chars as well. With my code as it is, it will order chars correctly i.e. sort the numbers out …

My code: [CODE] cout.setf(ios_base::fixed, ios_base::floatfield); plan++; double Annually, Monthly, Daily; Annually = CompoundAnnually (principal, rate, years); Monthly = CompoundMonthly (principal, rate, years); Daily = CompoundDaily (principal, rate, years); cout << setw(3) << plan << "\t"; cout.precision(0); cout << setw(10) << principal << "\t"; cout.precision(1); cout << setw(7) << rate << …