64,152 Solved Topics
Remove Filter  | |
| | In an ancient land, the beautiful princess Eve had many suitors. She decided on the following procedure to determine which suitor she would marry. First, all of the suitors would be lined up one after the other and assigned numbers. The first suitor would be number 1, the second number … |
| | hey guys, I wanna use a transparent panel so as to place it on the top of other controls without hidding them and If I draw some lines on this panel those lines will appear on the top of the controls. when I set the backcolor to transparent it desn't … |
 | Hello guys, I'm a newbie to asp.net....I've recently designed a website in which I've taken a gridview control and added a [B]button in the itemtemplate[/B] field of the gridview........What I want is that if anyone clicks on this button then the data in the particular row of the gridview comes … |
| | :) Hey , Im creating a small application to convert pendrives from [B]FAT[/B] format to [B]NTFS[/B] :| but i have a small problem.. [CODE] Process p = new Process(); string d = txtPath.Text.ToString(); d = d.Substring(0, 2); p.StartInfo = new ProcessStartInfo("cmd", "/c \"format '+ d' /fs:ntfs" ); p.Start(); p.Close(); [/CODE] … |
| | I'm in the beginning stages of writing (and learning as I go) a Python database app using SQLite. I have the db structure planned on paper, and I have the queries I'll need in mind, but before I start coding I want to fully test the db design to make … |
| | hello all, im using the code below now to extract table of contents from a html page. it extracts the data which is available after the <table> tag. but what i need is to get the result which appear as though it appear on that html page. [i need the … |
| | Hello Can someone get me started in the effert to fix this SQL statement to be excepted to create a table in a derby embeded db? [code] public boolean createTables(Connection conn) throws FileNotFoundException, IOException { System.out.println("in createTables:"); boolean createdTables = false; Statement stmt=null; try { String thisTable=ModelUtils.getXMLResource("createAdminTable"); System.out.println("thisTable sql String: … |
| | Hi, i'm trying to creating a program on c++ which relates to weight this is my problem so far [CODE] cout << "Enter weight between 1 to 60KG" << endl; cin >> weight; if (weight >= 1 && weight <= 60) cout << "Your weight is accepted" << endl; if … |
| | hey guys/gals im havin a problem in my test.cpp file in line 65 where i have cout << date.print(); the compiler says: test.cpp: In member function âvoid Test::print() constâ: test.cpp:67: error: no match for âoperator<<â in âstd::cout << ((const Test*)this)->Test::date.Date::print()â where am i making a mistake because i have <iostream> … |
| | OK I have made a little progress and now face something else. I will paste my code here. OK here goes. I am loading a php page from another page by clicking on a table row. This table is filled with data from mysql. When i click on a row … |
| | I've got this applet to build with no errors but then I try to run it and when I click the button in the applet, nothing happens...at least, not in the applet. Instead, jGRASP gives me all this stuff and I don't understand a bit of it: ----jGRASP exec: appletviewer … |
 | Hi guys.Can you write a program that reads data through a com1 serial port that communicates with a plc using c++ and inline asm instead of the ladder logic interface? I work at a cinema as a projectionist and the whole booth is automated with a bunch of these monsters …  |
| | I followed a tutorial and built my own little program but get this message: Exception in thread "main" java.lang.NullPointerException at javax.swing.ImageIcon.<init>(Unknown Source) at Gui.<init>(Gui.java:27) at appls.main(appls.java:6) What to do? Here is my code btw [CODE]import java.awt.FlowLayout; import java.awt.event.ActionListener; import java.awt.event.ActionEvent; import javax.swing.JFrame; import javax.swing.JButton; import javax.swing.Icon; import javax.swing.ImageIcon; import javax.swing.JOptionPane; … |
| | Hi Guys, I'm a beginner programming with Python. This is my first program. The purpose of this program is to add two numbers and then give me the result. However, after that I want for it to ask me if I want to continue (y) or (n). I came with … |
 | [CODE]File tempFile = new File(fw.getAbsolutePath() + ".tmp"); BufferedReader br = new BufferedReader(new FileReader(fw)); PrintWriter p = new PrintWriter(new FileWriter(tempFile)); String serData=(String)loadService().elementAt(i); StringTokenizer st = new StringTokenizer(serData, ":"); String code=st.nextToken(); String name=st.nextToken(); if (!name.trim().equals(deleteString)) { p.println(st); p.flush(); } p.close(); br.close(); if (!fw.delete()) { System.out.println("Could not delete file"); return; } //Rename the … |
| | I need help creating a python function that makes concentric circles. I already have a function that makes a circle(from the Python Programming book), so I thought I'd use a for loop; however, I'm not sure how. Here's what I have so far: (where 'number' is the number of circles, … |
| | Hi, I am writing a program for my C++ class that must create a struct(Hero) and make an array of it. My class is using the lvp library and i was wondering if anybody could help me make a vector of hero objects. This is what i have so far: … |
| | //Program checks employment status, if part time, NO VACATION, if full time, program goes into if/else nest and asks for number of years working at company. More than five years,full time employee granted 3weeks of vacation. Five years or less, full time employee is granted 2weeks of vacation. [CODE]#include <iostream> … |
| | i am writing a small script and part of it requires comparing two version strings in the form V[1-9].[0-9].[0-9].[0-9] The script will perform some action if the two strings have different subversions (STRING1=V1.1.0.2 and STRING2=V2.1.0.4 for example). So far the script is [CODE]for i in {1..4} do if [ $STRING1[(ws:.:)$i] … |
| | I want view web page by http connection in j2me but the output is html code if any one can help me please replay |
| | Another question, Is there a way in php to send emails without having to use the "mailto:" ? Most everything I have seen uses this method, but a lot of people don't use MS Outlook. Thanks Dan |
| | i was having fun with php until i hit this road block... geolocation.class.php is in the same directory as my index.php.. anyone has any idea why it can't find it? =( /* * this is part of the index.php * / [code] <div id="midBox"> <table border="0" align="left"> <tr><td><script type="text/javascript"> var … |
 | --Homework-- Write a C program that codes a string which is given by keyboard so that the coded string includes characters with their number of sequential occurrences. For example, if the string to be coded is AAABBFFFRRRRZTT then the coded string must be A3B2F3R4Z1T2. You can assume that there is … |
| | hey guys. okay, I know how to count form values. something like; <?php echo count($_POST['field']; ?> where the field would be something like field[i] however, I am cracking my head to get a solution to count, but only where the field has a value. Please, someone, help me with this … |
| | hi i'm currently in need of a quit option i have something like for example click 2 for quit but i don't know how to make a command for it, could someone please help me |
| | Hey all I have a problem in my code I can't seem to find a solution for.. One combobox is being filled up with a datatable like this: [CODE]CbUsers.Datasource = usersDAO.getUsers()[/CODE] The getUsers() returns a datatable from my acces database. Users have a name and id, I want to use … |
| | Hi, I am trying to cobble together a couple of snippets that I have found on the net to read and write to an ini file. The reading and writing part works fine but what I am trying to do now is to check if the ini file actually exists … |
| | I've gotten this applet to do some of what it should but I'm having trouble getting it to do the rest. It's a multiplication applet that asks the user a question such as "What is 6 times 7?", has a JTextField for the user's answer, and a JButton to check …  |
| | Hi All, Im Thiyagu, a junior software developer(Java/J2ee). I have assigned to access Webservice (sending request and receiving response from a WSDL). can any tell me the steps involved to convert Java code from a WSDL file using Axis(with ant build script). please very urgent. Note : I already tried … |
| | I've got this code that creates a Table and a graph, the values have to be int for the graph. But in the table I want t display the values as... 1,000,000 How can I do this?? [code] public partial class output : System.Web.UI.Page { int max = 0; int … |
| | Ok so the other day i was playing a game on facebook and decided to make a program to make it faster to play the game and save some time. i made a simple auto clicker with some hotkeys to start/stop and then added some text boxes and some more …  |
| | i write now code the game of hang man i want code sound in eclipse if true or false Brief sound teacher she said the cod is one line after Loading any sound plaaaaaaaaaase i want help  |
| | Hi All, I have developed a web application using jps. I have a user pages, which can be accessed after entering login credentials. If a user tries to go the a certain page directly without logging in, it directs to login page, this works perfectly in all browsers except mozilla. … |
| | Hey I'm new here so forgive me if I do something wrong. Just let me know and I'll try to fix it. Basically I'm trying to write a binary search tree without using recursion. (Difficult I know, but if you can show me how to do it without changing the … |
 | Hi I want to compile py files to com files. Please help me. thanks.  |
| | Hello... I'm having a real hard time with displaying the proper data in Project Summary. First off, I am using an Access database to bring in the data. Total hours are being calculated correctly. Rates are as well. I tested using a messagebox to make sure the rates are being … |
| | Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … |
| | Ok guys, I've kind of got this file half way working, but I get this message: [B]Notice: Undefined index:[/B] uploadedfile on line whatever. along with this: The file has been uploaded. which is the good part. But I don't understand why I always get those undefined errors. [CODE]$uploaded_size =''; $uploaded_type … |
| | I'm trying to find the product of two numbers using a function which receives the values of two variables from main() and the address of the variable prd where the product will be stored. I can't get this compiling because i get the following errors from Visual Studio C++ 2010 … |
| | Hello-- Inside of a header file (Point.h), I've created a class template. I need to override the addition operator as shown below, so what I have done is declared it as a [I]friend[/I]. However, when I try to access the private member variable [I]std::vector<T>coord[/I] from within the body of the … |
| | hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …  |
| | I am using scipy distribution scipy-0.4.9.win32-py2.4.exe with python 2.4 on Windows XP. When I try to import scipy I get the following error. [code] Traceback (most recent call last): File "<pyshell#4>", line 1, in ? from scipy import * File "D:\Python24\lib\site-packages\scipy\__init__.py", line 33, in ? del lib NameError: name 'lib' … |
| | Hi, I've been trying to capture video from webcam using openCV functions and openGL for rendering. The code is working fine and I can acquire and display both the cameras. Now I'm trying to record the captured video's and saving them to a file using openCV createvideowriter object. I can … |
| | What a great site! I'm looking fo a hint. I'm new to any type of programming and this C code just doesn't seem to be working. I have attempted a program that gives the ohm value of a resistor when the color code is entered in. I am using an … |
| | Hi I'm using wamp on my local machine. I have my form and php script made but I'm not sure how to place my folder to recieve the file. ie:[CODE]move_uploaded_file($_FILES['file_that_was_uploaded']['tmp_name'], $_SERVER['DOCUMENT_ROOT'] . '/images/' . $final_filename);[/CODE] I'm not sure how to set my path on the serve for my images folder. … |
| | Hey, So I have a small Flash application that plays a sound when a new message is received in a chat-box. The flash player is on a page embeded with an iframe. [CODE=html]<iframe width="1" height="1" frameborder="0" name="alerter" src="/chatbox/flash/alert/sound.php" id="chat_alert"></iframe>[/CODE] In the parent window, a variable called new_message is used to … |
 | I'm working on an addon system for one of my projects. I'm able to add a new menu item, but the self.Bind(...) is causing me troubles instead of bind the function to the menu-item, it just calls the function. and doesn't bind at all... :s [code=python]self.ID_OPEN=wx.NewId() wxglade_tmp_menu.Append(self.ID_OPEN, eval(menucontent)[i][0], "", eval("wx.ITEM_"+eval(menucontent)[i][1])) … |
| | I am trying to access a Mysql Server through Lan using VB6 using ADODB connection db.Open "DRIVER={MySQL ODBC 5.1 Driver};DATABASE=xxxx;SERVER=192.168.1.6;USER=root;PASSWORD=xxxx;OPTION=3;" it is giving error [Mysql][ODBC 5.1 Driver]host couldn't connect to the Mysql Server My Server IP is :192.168.1.6 user is: root Firewalls are turned off.... Might be i need to …  |
| | Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … |
| | Hi I recently learnt how to do crash collision based on colours. So you can use something like img.getpixel(0,0) to retrieve the colour of the pixel at (0,0) on the picture "img." I have experimented quite a lot with it and have managed to make some programs that draw a … |
The End.