Software Development Forum

[CODE] Select Case (e.Index) Case 0 If Alarmlvl = 3 Then bwcolor = Brushes.Gold ElseIf Alarmlvl = 2 Then bwcolor = Brushes.Black ElseIf Alarmlvl = 1 Then bwcolor = Brushes.BlueViolet End If Case 1 bwcolor = Brushes.Gold If Alarmlvl = 3 Then bwcolor = Brushes.Gold ElseIf Alarmlvl = 2 Then …

Hi everyone, I am using Ubuntu 7.10, and I have Java and MySQL installed with the command line as follow: 1. sudo apt-get install sun-java6-jdk 2. sudo apt-get install mysql-server and my JAVA and MySQL are working well, but now I want create connection between JAVA application and MySQL using …

Hello all. I'm almost certain this question has been posted before, but I couldn't find it--I apologize if it's a repeat. Anyway, I'm having a peculiar problem using getline when reading to a file. I know exactly how the file will be formatted, except the presence of comments at the …

I have a datagridview with data in it. I want to search the whole datagridview with a searchbox. This is the code I am using but it only searches the 'model' column not also the 'make' column. [CODE] DataView Dv = new DataView(); Dv.Table = partsDataSet.Tables["partsTable"]; Dv.RowFilter = " Make …

Im working on this bit of code below, The only thing im worried about editing atm is the self.toggle() and self.hello(). Im currently getting this error TclError: unknown option "-menu" from this line of code self.config(menu=menubar), does anyone know how i could fix this problem?? [CODE] from Tkinter import * …

Hey everyone, I need some help on some simple Python programming, below is my problem: Identify numbers or words in any .txt file that aren't listed in a provided .txt file and to output those numbers or words that aren't in the text file one per line, in alphabetical or …

hello can you help me please.. i have this trapping that will trap the characters..but my problem my code is too long..are there other ways to shorten my code..please help me ...hoping for your positive responds... [CODE]Public Function mchnotrap(KeyAscii As Integer) If KeyAscii >= 33 And KeyAscii <= 44 Or …

Heya , I was thinking of making a site opener application :). But I had a lots of problems . The next problem is facing this , it just crashes.:( [B]What do I want my program to do ?[/B] I want to assign a nickname for each of my favorite …

:( im new in vb.net i read some tutorial i still dont understand on how to retrieve data from sql server into datagrid. can someone teach me on how to set it. if got easy tutorial for me also can i have a button call "retrieve" and when i click …

Hi I'm trying to pass data from one page to another, but it does not display anything, Page 1: [code] protected void submit_Click(object sender, EventArgs e) { addData(); Session["value"] = space_01.Text; } public void addData() { string tenderDate = start_txt.Text; string cost = totalCost.Text; string companyName = name_txt.Text; string scon …

hi im trying to read a txt file and could you please check what is wrong with this? this is my code [CODE]// This program will calculate the charges for shipping #include <iostream> #include <iomanip> #include <string> #include <cstdlib> using std :: ifstream; using namespace std; int main() { // …

In an ancient land, the beautiful princess Eve had many suitors. She decided on the following procedure to determine which suitor she would marry. First, all of the suitors would be lined up one after the other and assigned numbers. The first suitor would be number 1, the second number …

hey guys, I wanna use a transparent panel so as to place it on the top of other controls without hidding them and If I draw some lines on this panel those lines will appear on the top of the controls. when I set the backcolor to transparent it desn't …

:) Hey , Im creating a small application to convert pendrives from [B]FAT[/B] format to [B]NTFS[/B] :| but i have a small problem.. [CODE] Process p = new Process(); string d = txtPath.Text.ToString(); d = d.Substring(0, 2); p.StartInfo = new ProcessStartInfo("cmd", "/c \"format '+ d' /fs:ntfs" ); p.Start(); p.Close(); [/CODE] …

I'm in the beginning stages of writing (and learning as I go) a Python database app using SQLite. I have the db structure planned on paper, and I have the queries I'll need in mind, but before I start coding I want to fully test the db design to make …

hello all, im using the code below now to extract table of contents from a html page. it extracts the data which is available after the <table> tag. but what i need is to get the result which appear as though it appear on that html page. [i need the …

Hello Can someone get me started in the effert to fix this SQL statement to be excepted to create a table in a derby embeded db? [code] public boolean createTables(Connection conn) throws FileNotFoundException, IOException { System.out.println("in createTables:"); boolean createdTables = false; Statement stmt=null; try { String thisTable=ModelUtils.getXMLResource("createAdminTable"); System.out.println("thisTable sql String: …

Hi, i'm trying to creating a program on c++ which relates to weight this is my problem so far [CODE] cout << "Enter weight between 1 to 60KG" << endl; cin >> weight; if (weight >= 1 && weight <= 60) cout << "Your weight is accepted" << endl; if …

hey guys/gals im havin a problem in my test.cpp file in line 65 where i have cout << date.print(); the compiler says: test.cpp: In member function âvoid Test::print() constâ: test.cpp:67: error: no match for âoperator<<â in âstd::cout << ((const Test*)this)->Test::date.Date::print()â where am i making a mistake because i have <iostream> …

I've got this applet to build with no errors but then I try to run it and when I click the button in the applet, nothing happens...at least, not in the applet. Instead, jGRASP gives me all this stuff and I don't understand a bit of it: ----jGRASP exec: appletviewer …

Hi guys.Can you write a program that reads data through a com1 serial port that communicates with a plc using c++ and inline asm instead of the ladder logic interface? I work at a cinema as a projectionist and the whole booth is automated with a bunch of these monsters …

I followed a tutorial and built my own little program but get this message: Exception in thread "main" java.lang.NullPointerException at javax.swing.ImageIcon.<init>(Unknown Source) at Gui.<init>(Gui.java:27) at appls.main(appls.java:6) What to do? Here is my code btw [CODE]import java.awt.FlowLayout; import java.awt.event.ActionListener; import java.awt.event.ActionEvent; import javax.swing.JFrame; import javax.swing.JButton; import javax.swing.Icon; import javax.swing.ImageIcon; import javax.swing.JOptionPane; …

Hi Guys, I'm a beginner programming with Python. This is my first program. The purpose of this program is to add two numbers and then give me the result. However, after that I want for it to ask me if I want to continue (y) or (n). I came with …

[CODE]File tempFile = new File(fw.getAbsolutePath() + ".tmp"); BufferedReader br = new BufferedReader(new FileReader(fw)); PrintWriter p = new PrintWriter(new FileWriter(tempFile)); String serData=(String)loadService().elementAt(i); StringTokenizer st = new StringTokenizer(serData, ":"); String code=st.nextToken(); String name=st.nextToken(); if (!name.trim().equals(deleteString)) { p.println(st); p.flush(); } p.close(); br.close(); if (!fw.delete()) { System.out.println("Could not delete file"); return; } //Rename the …

I need help creating a python function that makes concentric circles. I already have a function that makes a circle(from the Python Programming book), so I thought I'd use a for loop; however, I'm not sure how. Here's what I have so far: (where 'number' is the number of circles, …

Hi, I am writing a program for my C++ class that must create a struct(Hero) and make an array of it. My class is using the lvp library and i was wondering if anybody could help me make a vector of hero objects. This is what i have so far: …

//Program checks employment status, if part time, NO VACATION, if full time, program goes into if/else nest and asks for number of years working at company. More than five years,full time employee granted 3weeks of vacation. Five years or less, full time employee is granted 2weeks of vacation. [CODE]#include <iostream> …

i am writing a small script and part of it requires comparing two version strings in the form V[1-9].[0-9].[0-9].[0-9] The script will perform some action if the two strings have different subversions (STRING1=V1.1.0.2 and STRING2=V2.1.0.4 for example). So far the script is [CODE]for i in {1..4} do if [ $STRING1[(ws:.:)$i] …

I want view web page by http connection in j2me but the output is html code if any one can help me please replay

--Homework-- Write a C program that codes a string which is given by keyboard so that the coded string includes characters with their number of sequential occurrences. For example, if the string to be coded is AAABBFFFRRRRZTT then the coded string must be A3B2F3R4Z1T2. You can assume that there is …

hi i'm currently in need of a quit option i have something like for example click 2 for quit but i don't know how to make a command for it, could someone please help me

Hey all I have a problem in my code I can't seem to find a solution for.. One combobox is being filled up with a datatable like this: [CODE]CbUsers.Datasource = usersDAO.getUsers()[/CODE] The getUsers() returns a datatable from my acces database. Users have a name and id, I want to use …

Hi, I am trying to cobble together a couple of snippets that I have found on the net to read and write to an ini file. The reading and writing part works fine but what I am trying to do now is to check if the ini file actually exists …

I've gotten this applet to do some of what it should but I'm having trouble getting it to do the rest. It's a multiplication applet that asks the user a question such as "What is 6 times 7?", has a JTextField for the user's answer, and a JButton to check …

Hi All, Im Thiyagu, a junior software developer(Java/J2ee). I have assigned to access Webservice (sending request and receiving response from a WSDL). can any tell me the steps involved to convert Java code from a WSDL file using Axis(with ant build script). please very urgent. Note : I already tried …

Ok so the other day i was playing a game on facebook and decided to make a program to make it faster to play the game and save some time. i made a simple auto clicker with some hotkeys to start/stop and then added some text boxes and some more …

i write now code the game of hang man i want code sound in eclipse if true or false Brief sound teacher she said the cod is one line after Loading any sound plaaaaaaaaaase i want help

Hey I'm new here so forgive me if I do something wrong. Just let me know and I'll try to fix it. Basically I'm trying to write a binary search tree without using recursion. (Difficult I know, but if you can show me how to do it without changing the …

Hi I want to compile py files to com files. Please help me. thanks.

Hello... I'm having a real hard time with displaying the proper data in Project Summary. First off, I am using an Access database to bring in the data. Total hours are being calculated correctly. Rates are as well. I tested using a messagebox to make sure the rates are being …

Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should …

I'm trying to find the product of two numbers using a function which receives the values of two variables from main() and the address of the variable prd where the product will be stored. I can't get this compiling because i get the following errors from Visual Studio C++ 2010 …

Hello-- Inside of a header file (Point.h), I've created a class template. I need to override the addition operator as shown below, so what I have done is declared it as a [I]friend[/I]. However, when I try to access the private member variable [I]std::vector<T>coord[/I] from within the body of the …

hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …

I am using scipy distribution scipy-0.4.9.win32-py2.4.exe with python 2.4 on Windows XP. When I try to import scipy I get the following error. [code] Traceback (most recent call last): File "<pyshell#4>", line 1, in ? from scipy import * File "D:\Python24\lib\site-packages\scipy\__init__.py", line 33, in ? del lib NameError: name 'lib' …

Hi, I've been trying to capture video from webcam using openCV functions and openGL for rendering. The code is working fine and I can acquire and display both the cameras. Now I'm trying to record the captured video's and saving them to a file using openCV createvideowriter object. I can …

What a great site! I'm looking fo a hint. I'm new to any type of programming and this C code just doesn't seem to be working. I have attempted a program that gives the ohm value of a resistor when the color code is entered in. I am using an …

I'm working on an addon system for one of my projects. I'm able to add a new menu item, but the self.Bind(...) is causing me troubles instead of bind the function to the menu-item, it just calls the function. and doesn't bind at all... :s [code=python]self.ID_OPEN=wx.NewId() wxglade_tmp_menu.Append(self.ID_OPEN, eval(menucontent)[i][0], "", eval("wx.ITEM_"+eval(menucontent)[i][1])) …

Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should …

Hi I recently learnt how to do crash collision based on colours. So you can use something like img.getpixel(0,0) to retrieve the colour of the pixel at (0,0) on the picture "img." I have experimented quite a lot with it and have managed to make some programs that draw a …