132,726 Archived Topics
Remove Filter ![]() | |
this project is to determine if a phone number is a prime number. if the number is a prime number then print a message to the effect. if the number is not a prime number then print the prime factors of the number. allow the user to continue entering numbers … Software Development java | |
I'm writing a program that reads information from three seperate classes. Here is my code: [CODE] public class Animal { protected int id; protected String type; protected double mass; //------------------------------------------------------------------------ // Sets up an animal with the specified ID number, type and weight. //------------------------------------------------------------------------ public Animal (int animalID, String animalType, … Software Development java | |
I am working on an assignment where I am to create a mortgage calculator that allows the user to input there mortgage amount, term and interest rate. The following is what I have so far. The errors I keep coming up with are the following: The Decimal Format the for … Software Development java open-source | |
Exception Error: [code] private void Form1_Load(object sender, EventArgs e) { SqlConnection conn = new SqlConnection(); conn.ConnectionString = "Data Source=LINLINPC\\SQLEXPRESS;Initial Catalog=POS;Integrated Security=True"; conn.Open(); MessageBox.Show("Connection"); conn.Close(); } [/code] I got this error(The type initializer for 'System.Data.SqlClient.SqlConnection' threw an exception.) Software Development open-source sql | |
does anyone konw why is this code giving an error saying: There is already an open DataReader associated with this Command which must be closed first. the error is coming form the place where i have cold the line the code is below: C# Syntax [CODE] public String[] LoadUSEmp() { … Software Development | |
Ok so the other day i was playing a game on facebook and decided to make a program to make it faster to play the game and save some time. i made a simple auto clicker with some hotkeys to start/stop and then added some text boxes and some more … Software Development vb.net | |
Please help me to write a shell script to find the GCD (Greatest common Divisor) of [B]3[/B] numbers. Thanks in advance. Software Development shell-scripting | |
Write a C program to enter the elements of three one dimensional array A (size 5), B (size 10) and C (size 5) as an input from the keyboard. The program will find and print: • The maximum element of array A entered as an input. • The minimum element … Software Development c | |
i write now code the game of hang man i want code sound in eclipse if true or false Brief sound teacher she said the cod is one line after Loading any sound plaaaaaaaaaase i want help Software Development c++ | |
Hey I'm new here so forgive me if I do something wrong. Just let me know and I'll try to fix it. Basically I'm trying to write a binary search tree without using recursion. (Difficult I know, but if you can show me how to do it without changing the … Software Development c++ | |
Sever.java file [CODE]import java.net.*; import java.io.*; import java.util.*; /** * Simple server use to teach University of * Northumbria's Operating Systems and Networks modules. * To be used with compatible simple client. * <PRE> * Protocol: * client <---message--- server * message = <message body> CRLF * </PRE> * * … Software Development client-server java operating-system | |
i am trying to merg two linked list. error occurs when i run the program it dead. i believe it is because the function i defined to merge these two list has problems would someone helpe me to fix it or some hint would be nice thanks[code]#include <stdio.h> #include<malloc.h> typedef … Software Development c++ linked-list | |
Hello all, I am in need of a dll that, if passed the shortcut/.lnk name and the Start Menu -> Programs path if needed, will return the target attribute of that shortcut. I am going to be calling this from a Lua script based application from Indigo Rose called AutoPlay … Software Development c | |
I'm trying to create a simple network with perceptions and it doesn't seem to be working. I was wondering if someone could correct my mistakes. Thanks! [CODE]#include<iostream> #include<cstdlib> using namespace std; int pWeights[] = {0,0}; int Classify(int pInput, int pThreshold, int i, int Bias){ int classOut; if( pInput*pWeights[i] + Bias … Software Development c++ | |
How can I fix this so it will let me compare the two? note, the error is at the for loop. [CODE]string Socket::Recv() { /* Get socket size before recv'ing */ while (size == 0) ioctlsocket(client, FIONREAD, &size); /* Create a 'string (characters)' the size of the information being recv … Software Development c++ | |
Hello... I'm having a real hard time with displaying the proper data in Project Summary. First off, I am using an Access database to bring in the data. Total hours are being calculated correctly. Rates are as well. I tested using a messagebox to make sure the rates are being … Software Development pay-per-click vb.net | |
Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … Software Development java java-swing | |
We are creating a Who wants to be a millionaire style game in VB. Our server is pulling information such as questions and answers from a Access Database and sending them to the contestants (Clients). All transfer of information is directly from the server to each client. One of the … Software Development client-server multithreading vb.net | |
Im trying to make a bac calculator and make a gui for it but am having issues with the math code for it. Here's my code. Everything I input returns 0. The BAC forumula is (150/body weight)(% alcohol/50)(ounces consumed)(0.025). Btw, I suck at math so it could be a math … | |
I'm trying to find the product of two numbers using a function which receives the values of two variables from main() and the address of the variable prd where the product will be stored. I can't get this compiling because i get the following errors from Visual Studio C++ 2010 … Software Development c visual-studio | |
Hello-- Inside of a header file (Point.h), I've created a class template. I need to override the addition operator as shown below, so what I have done is declared it as a [I]friend[/I]. However, when I try to access the private member variable [I]std::vector<T>coord[/I] from within the body of the … Software Development c++ | |
hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] … | |
I need to do the following program, but it need to have a do while loop, scanner for input, and a console program. Here are the instructions: Write a Java program that prompts the user for how many individuals they will be entering. Then program will then prompts for each … Software Development java | |
I am using scipy distribution scipy-0.4.9.win32-py2.4.exe with python 2.4 on Windows XP. When I try to import scipy I get the following error. [code] Traceback (most recent call last): File "<pyshell#4>", line 1, in ? from scipy import * File "D:\Python24\lib\site-packages\scipy\__init__.py", line 33, in ? del lib NameError: name 'lib' … Software Development python | |
hi, I am a new member here i hope that found some one who can help me in this C++ project I am a novice in C++ and this will be my first code if any one has experience please help me in the algorithm and what should i do … | |
Hi, I've been trying to capture video from webcam using openCV functions and openGL for rendering. The code is working fine and I can acquire and display both the cameras. Now I'm trying to record the captured video's and saving them to a file using openCV createvideowriter object. I can … Software Development asp.net c++ visual-studio | |
java.awt.*; import javax.swing.*; import java.awt.event.*; class Getaction implements ActionListener{ String am = ""; String req ; String em = ""; String oper = ""; double x,y ,result; String res; Addcomp get = new Addcomp(); public void actionPerformed(ActionEvent ev){ req = ev.getActionCommand(); if((req.equals("1")) ||(req.equals("2"))||(req.equals("3"))||(req.equals("4"))||(req.equals("5")) ||(req.equals("7"))|| (req.equals("8"))||( req.equals("9")) ){ if (oper == … Software Development java java-swing | |
What a great site! I'm looking fo a hint. I'm new to any type of programming and this C code just doesn't seem to be working. I have attempted a program that gives the ohm value of a resistor when the color code is entered in. I am using an … Software Development c | |
hello geys, i have some codes and i tried to find the output for each of them. most of the codes i answered but there are some codes which are strange for me (the output) first, i want from every one is to find the output without test it, please … Software Development c++ | |
[CODE]template<class type> struct _binary_search_tree { type key; struct _binary_search_tree* parent; struct _binary_search_tree* left_child; struct _binary_search_tree* right_child; }; template<class type>void tree_insert(_binary_search_tree<type>** tree, type key); int main() { char number[10]; _binary_search_tree<char*> root; tree_insert(&root, number); }[/CODE] [QUOTE]compile error: 755.c:182: error: no matching function for call to ‘tree_insert(_binary_search_tree<char*>*, char [10])’[/QUOTE] Thanks. Software Development c++ | |
hallo guys.i am newbie at java and i want ur help. i have created the 5 five buttons but not the action listeners for them. the five buttons are : add person, see ll persons, search a person,update a person, delete person.so when i press add person the programm should … Software Development gui java java-swing | |
Hi i have some problem with the listview control i dont know how to use it here is what i wanna do [code] sub mysub() handles myEvent for i=0 to 3 Dim lv As ListViewItem = ListView1.Items.Add(x(i)) lv.SubItems.Add(x(i)) lv.subitems.add(x(i)) ... next end sub [/code] so when the next event occurs … | |
I'm working on an addon system for one of my projects. I'm able to add a new menu item, but the self.Bind(...) is causing me troubles instead of bind the function to the menu-item, it just calls the function. and doesn't bind at all... :s [code=python]self.ID_OPEN=wx.NewId() wxglade_tmp_menu.Append(self.ID_OPEN, eval(menucontent)[i][0], "", eval("wx.ITEM_"+eval(menucontent)[i][1])) … Software Development python python-django | |
Hello there. This is my first post in this forum which, by the way, I find outstanding simply because everytime I google a C problem I find an answer here. Ok so, I have a very simple problem. I use Windows 7 and recently had a major problem about my … Software Development c | |
Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … Software Development java java-swing | |
Hi I recently learnt how to do crash collision based on colours. So you can use something like img.getpixel(0,0) to retrieve the colour of the pixel at (0,0) on the picture "img." I have experimented quite a lot with it and have managed to make some programs that draw a … Software Development vb.net | |
I have spent over a WEEK trying to figure out why my code isn't working. It's a long code, I will post it all but I will break down the code as I explain. First off, I have called double[] arrays and then initialized them later on in the program … Software Development java java-swing window-manager | |
Anyone to help with protected mode programming,like help me create a a data descriptor pointing to 0b800h when i try to write to RAM it rebbots Software Development assembly | |
my teacher wants the tictactoe game to have a button called play that resets the tictactoe game my button doesn't work....what did i do wrong? [CODE] //TicTacToePanel.java Author Carien Anderson //Represents tic tac toe game board and allows peer to peer competition import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.JOptionPane; … Software Development java java-swing peer-to-peer | |
I need help with using a DATEDIFF() function in sql query cn i get an example of hw 2 do it...pls help..thnx in advance Software Development sql | |
I have this 2d array that sorts the rows but i can't sort the column.. i can't figure it out for the life of me. PLEASE HELP Please enter size of row between 1 - 20: 5 Please enter size of column between 1 - 20: 5 Your matrix is … Software Development java matrix-multiplication | |
Hi i'm a new student in java and would appreciate anyone helping me get through. I do not want you to do my work because that won't help me get through the next and next assignments however I would appreciate your help putting me on the right track such as … Software Development java | |
ALl i need to find is the sum of digits of a given number until the sum becomes a single digit. (e.g. 12345=>1+2+3+4+5=15=>1+5=6).I have coded with some logic and i could able to find the sum til this part 12345=>1+2+3+4+5=15 but i couldn able to carry on after that plz … | |
Hi!!! I have made a window application with MS access database to analysis student performance in his class for each exam that he appeared for. I have a table named result with following fields: classname,sectionname,subjectname,exam type,rollno,studentname and marks. On one form I have taken crystal reportviewer and 5 comboboxes for … Software Development | |
All I want to know is that how is that L1.exe protected with that coding? What is that technology called? What is the software used for making this? How is the code generated? Note that MID & Site code will wary from system to system. This file cannot be run … Software Development visual-basic | |
I have a brand new computer which was freshly loaded with Visual Basic 6.0. I have copied all the code from the previous computer to this new one. But loading a project produced the following error. Class MSGrid.Grid of control grdS101 was not a loaded control class. So I did … Software Development hard-drive visual-basic | |
Attached are a C file, a .i file, and a Makefile that I thought could produce a Python-loadable binary. Also, I included a text file with the output I got showing the failure. It looks like I didn't include something vital but I don't know what. Can anyone help me … | |
I have an assignment where I'm supposed to "implement a class, Point that represents a point in a three-dimensional space." and im supposed to "carefully design the interface for this class and include functions that appear to be useful for operating on points." I'm not fully sure what this is … Software Development c++ operating-system queue | |
i want it to print out 4 is larger than 2 but it prints out 2 is larger than 2293572 [CODE] #include <stdio.h> #include <stdlib.h> void largest(int num1, int num2, int *larger) { if(num1 > num2) { *larger = num1; } else{ *larger = num2; } } int main() { … Software Development c |
The End.