Software Development Forum

Hi, Here is the File content. I want to use strtok to separate each. but the problem is if i use `strtok(string, "\",");`, the zip code (19428) of the detail is miss place and take State (PA) for the first record Because of "," in State. Although the second one …

I'm trying to write a cout formatter that uses the comma operator and insertion operator. I wasn't able to get that to work so I decided to write it similar to std::boolalpha. when you use `std::boolalpha`, it is able to change 0 values to true and false and you can …

Hi, Currently, I have 3 listboxs' data, but I don't know how to create 3 columns and show them with datagrid control. Does anyone give me a guid line how to show listbox's data with datagrid? regards

This program reads in some numbers then outputs the numbers, low to high, by using a bubble sory. I need some help to start how to do the bubble sort on a linked list. Here is what i have so far. .h file #include<iostream> #include<fstream> #include<cstdlib> using namespace std; struct …

package battleship; public class BattleShip { public static void main(String[] args) { Addons a = new Addons(); Board b = new Board(); Computer c = new Computer(); Human h = new Human(); LinkedList list = new LinkedList(); while(a.intro()) { a.sleep(1); a.countDown(5); b.prepareBoard(); do { h.play(b.getBoard()); a.checkWinner(b.getBoard()); System.out.println("How the Board stands."); …

Quick question on stripping, I'm executing a simple program, but whenever I try and run it in Terminal, it strips all wrong. The error it puts out is below. It iterates [+]Trying: admin/admin for the first line, but wont repeat it for the rest of the lines, as well as …

[WinForms].I have 3 columns in a gridview - code,Qty,name.If a cell(Say Code), is in edit mode, pressing the arrow or tab keys will fire the 'CellEndEdit' event and after that,moves the selection to the next cell. I want to have different selected cell if it is an arrow key and …

public class HelloWorld{ static int a; public static void main(String []args){ System.out.println("Hello World"); HelloWorld h =new HelloWorld(); a = h.foo(); System.out.println(a); } int foo() { try{ throw new Exception(); } catch(Exception e){ System.out.println("catch"); return 9; } finally{System.out.println(a);return 10;} } } When I ran the above code output was: Hello World …

package battleship; import sun.audio.*; import java.io.*; public class Sound // Holds one audio file { public void playIntro() { AudioStream bGM; try{ bGM = new AudioStream(new FileInputStream("intro.wav")); AudioPlayer.player.start(bGM); } catch (IOException error){} } } I have that on one of my games and the music doesnt run, any help? If …

Hello, I need to know why this isn't working... I have tried many different things but still can't get it to work. (And, yes, I have replaced the MYPASSHERE with my password but it always says I have not registered yet...) Imports System.Net Imports System.IO Imports System.Text Public Class Form1 …

// code says misplaced else can some tell me why and if possible make the correction? #include<stdio.h> #include<conio.h> char oper; int num[2]; int ans; main() { clrscr(); printf("Num:"); scanf("%d",&num[0]); printf("+"); scanf("%c",&oper); { if(oper=='+') { printf("+"); } { printf("Num:"); scanf("%d",&num[1]); } ans = num[0] + num[1] ; printf("%d",ans); } { else …

Hello Friends, I am having trouble with a homework assignment and was wondering if you would please take a look at it for me. I have to write a program that receives a prefix expression. Then it calculates and displays the result. It does this by using a stack to …

I had a doubt in one of the usages of typedef. I want to know the meaning of this line: typedef char Text[80]; What is the meaning of this line and what does it do? Does it create an array of typedefs relating to char, or does it mean "Text …

Guys i'm having another problem here. I have a data report that prints the student's information but my problem is how to create a report that prints only one student because my report prints all the student. Thank you in advance.

can anyone help me understand this code part ? this is about binary minimum heap , ie root has the lowest key.. the part of the code im trying to understand checks whether the subtree ( of a certain minHeap pq[1..N] ), rooted at k is also a min heap …

hi pls I need someones help. i am not good at programming and i have this subject ; but i am a BSBA major. it is like free section for me and i want to learn it to so i can be flexible. but this project is getting all my …

Hi all How i can read txt file and put it into textbox? Please help me. Any help will be appreciated. Thank you

I am working on a keyboard teaching aid similar to mavis beacon. With the following code i am able to detect if the enter key is pressed on the keyboard. If e.KeyChar = Microsoft.VisualBasic.ChrW(keys.enter) Then MsgBox("Enter key is pressed") End If but what i want to do is that i …

While creating a module within my program, I created a second Dataset (and it's called DesignDataSet2). I would like to delete it from the database altogether. I have already removed the one datatable that was within this dataset. I now want to eliminate this completely. How do I go about …

Greetings guys how can i delete the selected items on the datagrid. I'm trying to search for some code but i can't find anything. And i need to finish this before thursday. i really need your help guys thanks!

I want to designe a code at display a perticular data Example a time table of the week For instance if someone view a page on monday so it show display result of the table or data which is set to display on monday or if some one view same …

This code wont doest display the answer why???/ #include <stdio.h> #include <conio.h> void main() { int opcode; int num[2]; int result; clrscr(); printf("Program for Addition, Subtraction, Multiplication and Division\n"); printf("Enter First Number:"); scanf("%d", &num[1]); printf("Enter Your Choice: 1 - Add, 2 - Sub, 3 - Mul, 4 - Div: "); …

Using Ubuntu 12.10 have been using python 2.7 and python 3.2 successfully. 2.7 is my default interpreter. Now, after installing python 3.3 it looks like the python3.3 version of "/usr/include/python3.3" was not installed (as it is for "usr/include/python3.2" . I have already done "sudo apt-get install python-dev" . I discovered …

This might be a very basic question but still I am not able to figure out why is the foll code giving stackoverflow exception in main?? public class HelloWorld{ public static void main(String []args) { System.out.println("Hello World"); Animal c = new Animal(); } } class Animal { Animal e = …

I wrote a code to represent the factory design pattern as below: package com.factory2; public interface CreditCheck { Double creditLimit(int id); } package com.factory2; public class CreditCheckFactory { public boolean isAgencyUp(){ return true; } public CreditCheck createCreditCheck(){ if(isAgencyUp()){ return new CreditCheckOnline(); }else{ return new CreditCheckOffline(); } } } package com.factory2; …

Dim oWord As Word.Application Dim oDoc As Word.Document Dim oTable As Word.Table Dim x As Integer Set oWord = CreateObject("Word.Application") oWord.Visible = True Set oDoc = oWord.Documents.Add Set rs = New ADODB.Recordset With rs .Open "SELECT * FROM ClientTable", cn, 2, 3 Dim r As Integer, c As Integer Set …

Iv been developing a parser using java, however due to testing on multiple machines i have errors now on one machine i corrected as the machine was using jdk/jre v1.6, and on my newer machine jdk/jre 1.7 The question i have is, what are the implications of using the String …

hi everyone :) what i'm trying to do is to check if word in a string has numbers in it for example: if i enter string of one word "he11o" i want to show error message that says "One or more characters are numeric! Please re-enter the word!" and if …

Hi all. I've been learning programming from the web for almost 2 years now and this'll be my first post ever on DaniWeb (or any forum ever). I have no experience with parallel programming but read about the simplicity of working with OpenMP, and that's what I need. Something that …

is it necessary to include base class in the header and or .cpp file of derived class?

Hi, I've just started out with Python and I've been stuck on this problem for a few hours now trying to parse a file into a certain format.. I am trying to create a list in a list out of a list. I currently have this list; ['MPNRRRCKLSTAISTVATLAIASPCAYFLVYEPTASAKPAAKHYEFKQAASIADLPGEVLDAISQGLSQFGINL', 'MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRSELPGWLQA', 'etc'] …

Hello everyone, I am puzzled... when I run a JUnit test, there is no main method in the class and it still runs. Alo, a java/maven web app does not have a main anywhere. My assumption is that it is hidden somewhere on some class I somehow extend or something. …

Hello guys, I really need your help on this one, Please help me out with it I'm using a webBrowser in my application "Visual Basic 2010", And what basically it will do, Once you open up the application, It will show you a URL, let's say for example Google.com by …

Hi everyone! I am having troubles making the second IF statment execute in my code: Pattern dl_noise_rates_p = Pattern.compile("\\d+\\s(.+)\\s(.+)\\s(.+)\\s(.+)"); Matcher dl_noise_rates_m = dl_noise_rates_p.matcher(lineString2); if(dl_noise_rates_m.find()){ String s_dl_nr1 = (dl_noise_rates_m.group(1)); //checking for non numbers pulled in the regex if(s_dl_nr1 == "NaN"){ //| s_dl_nr1 == "NaN" | s_dl_nr1 == " NaN" System.out.println ("OMGOMGOMGOMGOMGOMGOMGOMGOMG …

I am currently trying to pull high,low, and closing stock data from Yahoo finance, and graph it using Turtle. I was able to pull the data from the url into a list but I can't figure out how to graph it. I know the dates have to be the x-axis, …

I'm going through a netbeans tutorial on Java ecommerce located here: http://netbeans.org/kb/docs/javaee/ecommerce/setup-dev-environ.html When I get to "running the web project, step 1", I click the green run button in the NetBeans IDE. In my browser, it goes to http://localhost:8080/AffableBean, but no HTML is displayed. If I view the admin domain …

i want to set a collision on my tile map using getBounds function. level class int map[][] = { {2, 0, 0} {1, 1, 0} }; 2 = player 1 = ground 0 = sky i want to set collision so player cant go though ground. so he should fall …

Hi friends! I got one puzzle. I wonder if there is a way I can create a table but get a table name from a value of the textbox/combo box control. Does anyone have an idea? I mean something like "CREATE TABLE (TextBox1.Text) (".....)" I wonder if that is really …

Some time ago, Reverend Jim gave me some good advice on dynamically creating controls with VB.net. Following the advice, I created 26 Labels (with text A-Z) and a event handler for the click event of the labels. Now I need to determine WHICH label was clicked and the text of …

Hi this code is to fill up my Combo1 Item which is came from my Table1 .Combo_Main_AM.Items.Clear() Dim da As New OleDbDataAdapter("Select * from Table1", con) da.Fill(dt) For Each myRow In dt.Rows .Combo1.Items.Add(myRow.Item(0)) Next so it will add up the combo1 Jessie James Nick now the question is how can …

Hi there everyone, I am having some difficulties getting a regular expression to work. I have a line of text with 5 numbers.I want to ignore the first number, and grab the other 4 numbers. Here is what the text I am dealing with looks like. 1681 12.33754513 7.066246057 6.079261254 …

In main method which should I use? CarOwner owner = new CarOwner("Danni", "123456789"); or CarOwner owner = new CarOwner(); owner.setName("Danni"); owner.setPhoneNumber("123456789"); I know how to make both work, I can edit the class file to suit whichever way it is written in the main method. But what do people do …

I am having a dialog box opens that lets you select a picture and then copy that picture to another folder but the problem is that i am having an error that says that i can't convert a System::String to a LPCTSTR. I searched this subject on google but i …

I have problem reading file form command line. I am trying to do " abcd: ./rev < numbers", but it gives me an error: ./rev < numbers Usage : ./rev FILENAME Here is the code: #include <stdio.h> #include <stdlib.h> void reverse(FILE * file) { int fscanf_return_value; char x; /* read …

Hello, I am new here. I would like to ask opinion from you guys on what are the best options available for me to develop a database system using Visual basic? I am using Visual Basic Express Edition. My problem: I am currently developing a toolkit that needs the user …

Group, I've got several textboxes within a form that are set to link to a data column that are set to accept a "null" (blank) value. However, these columns are formated to receive numeric data. When the user bypasses entering anything within those textboxes (as they should do), what is …

I am tryn a currency converter using hash table. What is the technique to use to enble covert both ways. Ex: Dollers to Euro and Euro to Dollers . I can understand how to do it one way using currency as the hashKey and rate as Hashvalue. (I hope that …

Hello, Could you please assist me i want to deploy this application as an executable file with the MYSQL database embedded. I have clean and build the application, the jar file is there but nothing happens. The database is stored on local host. Thank you

hye guyz, Can any one tell me that what the data structure is used behind FACEBOOK ??? I have googled but not found any useful answer... plzz tell me quickly..

##TASK Step One The DNA molecule is a double-helix. You can think of this double helix as two parallel sequences of DNA with nucleotides or bases (A,C,G,Ts) on one strand matched with their associated nucleotide on the other strand according to the following rules: A matched with T C matched …