199,114 Archived Topics
Remove Filter  | |
| | This question has been bothering me all day. if I'm trying to pull out all strings that are in a txt file and all start with "abcde" is there anyway to find them, and copy the strings?? assuming the txt file contains lots of text |
| | Dear All, When i execute my queries for Edit and Save for edited subject, there is no updated in my sql database. Appreciate if anyone could lend me a hand for this issue. My queries are as below. Private ConnString As String = "server=localhost; Integrated Security=SSPI;Persist Security Info=False;database=carerpt" Public Sub …  |
| | Hi, I'm having a problem on how to query from the following tables. Here are the tables. PATIENT: PK - PatientNo - FirstName - LastName - MiddleName - Address - Age FK - PageNo PAGE PK - PageNo BOOK PK - BookNo BOOKPAGE 'Junction Table PK - BookNo PK - … |
| | I want to check weather my database contain row or not? and if it contain then i want to delete that row. this process can be done during run time of page. |
| | OK, here's my assignment: Write static methods public static double sphereVolume(double r) public static double sphereSurface(double r) public static double cylinderVolume(double r, double h) public static double cylinderSurface(double r, double h) public static double coneVolume(double r, double h) public static double coneSurface(double r, double h) that compute the volume and … |
 | [CODE]#this function checks if a number is a prime number, #if not it outputs the lowest factor. def isprime(n): """Determines whether a number is a Prime number, Takes a single arguement n, which is the number""" if n==1: return 'Not a Prime number, only has one distinct factor' elif n==2: … |
| | hi Q1 could anyone let me know what difference would it make to the program in terms of memory and program speed if i use arraylist or hastable or vectors Q2 which of this is better program practise declare separate vectors or arraylist for different data or use hashtable and …  |
| | |
| | I have this code: [CODE]protein="GWEIQPYVWDECYRVFYEQLNEEHKKIFKGIFDCIRDNSAPNLATLVRVTTNHFTHEQAMMDAVKFSEVLPHKKMHRDFLEKLGGLSAPVDNHIKGTDFKYKGKAKNVDYCKEWLVL" pp="LLCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHCLLLCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCL" gor="cccccccccccchhhhhhhhhhhhhhhhhhhhhhhccccccccceeeeecccccchhhhhhhhhhhcccchhhhhhhhhhhhhccccccccccccccccccccccceeceeccceec" aber="CCCCCCCCCCCCHHHHHHHCCHHHCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC" for i in range(len(protein)): print i+1,protein[i], pp[i], gor[i], aber[i] [/CODE] I'm trying to compare these strings. However, the output is in a vertical format. How can I print it so that the format is vertical? This would make it much easier to … |
| | Hey ...Now i want to compare the two things...I will explain my problem.. Now I got single items and their values For exmple: item: value 2 : 6 1 : 5 3 : 4 5 : 3 i want use this to swap the place for my combination for example, … |
| | i have a problem. i want to import multiple tables from a same excel sheet to a datalist or more.how can i identify different tables.please help anyone. advance thanks to all. |
| | Private Sub Command2_Click() CommonDialog1.ShowOpen Text5.Text = CommonDialog1.FileName Picture1.Picture = LoadPicture(Text5.Text) Text5.Visible = True End Sub |
| | write a program which uses a class with the name Student, the class will have as data - name - AM - grade1 - grade2 - grade3 all the data of the class have to be private the program will ask the elements of two students, it will save them … |
| | I've made java desktop application,swing gui in netbeans and it works in netbeans but I have 2 problems: 1. I cant export working jar or class files 2. I need to run and build it from cmd line in windows xp I guess that I need to include something in … |
| | hello all. i have this code... [CODE]<?php $query= "SELECT * FROM table"; $result=mysql_query($query) or die(mysql_error()); $num_rows = mysql_num_rows($result); if($num_rows > 0) { echo "<table>"; while($row = mysql_fetch_array($result)) { echo "<td>" . $row['data'] . "," . "</td>"; } echo "</table>"; } ?>[/CODE] lets say it is displaying from 5 records, it … |
| | Hi, I have a variable @FranchiseId declared in my stored procedure If I try the following select command, will it work???? SELECT @FranciseId=(select FranchiseName FROM franchise WHERE username=@username),username FROM MyTable I hope you Understood My problem!! |
| | i have one question--> umbrella activities occur throughout the software process. is it this way that they are applied evenly across the process, or are aome concentrated in one or more framework activities? i appreciate if i get the comments or answer |
| | I have a very simple WCF program where I have a simple self-host and a client running on the same computer. There is a single method which returns a System.IO.Stream, which is actually a serialized form of a simple string. (This could be any number of data types, but for … |
| | I have a form form1 and there is a search button for searching the doctor when i click search button then a new form opens i.e. form2 and in form2 there is a data grid view control and i want when i select any doctor and click on apply button … |
| | Hi all, I have this code for registration page, I have run some diagnostic tests and found that it is valnurable for Cross site scripting, any help??? or sugestion??? I have attached a copy of the report. Other pages had valnurabilities but very low.... I am not good at asp …  |
| | I am having a form through which user will enter empcode(checking whether it is present in the table) When i click On Login i am getting the following error [B]Invalid column name[/B] [B]cmd.CommandText = "select employee_code from MST_Employee where employee_code = " + emp_code; [/B] In the above select i … |
| | I am having trouble figuring out how to get my function (lines 45-57) to work. Option Strict is supposed to be on. I am getting the error "Option Strict On disallows implicit conversions from 'Decimal' to 'String'." This is an intro problem so its going to be basic. [CODE]Option Strict … |
 | Hi all, I want to save some form setting at registry, my friend told me that vb has a function to save it.. what it is? and how to use it? Please Help Thanks |
| | I have so much trouble in making this thing work. This is what i supposed to do: 1.build program to make histogram 2.The program should also calculate average and median. 3.The array should come from the text file. The problem is..i can build the histogram..but i have problem to get … |
 | >>Ok, so time() function (argument being null) returns what? It returns the number of seconds since 1970, as you previously posted. It doesn't matter whether the parameter is NULL or not, it will always return the same value. |
 | To preface this post I'm going to say that what I'm looking to do is purely in the theorhetical stages at this moment so I don't have any code to share yet. At it's basest essence what I'm attempting to do is compare Image A with Image B to determine … |
| | I usually program in java but I'm going to implement this in C but the general logic psuedo code should work I would think. these numbers represent these characters: 2-abc 3-def 4-ghi 5-jkl 6-mno 7pqrs 8-tuv 9-wxyz If I were to type in a 7 digit number say 233-7687 as … |
| | Problem while running program: java.lang.NoSuchMethodError: main Exception in thread "main" My code is: [CODE] import java.awt.*; import java.awt.event.*; import javax.swing.*; public class Plane extends JApplet implements ActionListener { JTextField input; JLabel prompt; JButton yesButton,noButton; int section, firstClass,economyClass; boolean seats[]; boolean questionPosed= false; public void main( String args[] ) { prompt … |
| | Currently I have a windows service written in C# (running as LocalSystem) which creates a user account, needed for impersonation, by using the DirectoryEntry to add the user/password and associated UserFlags. Then it simply uses this account to perform some tasks (using impersonation) using the LogonUser() functionality - works perfectly. … |
| | Basically I have a label which I do the following with on start up of my application: [code] with Label1 do begin Caption := 'Computer Locked'; Align := alClient; Alignment := taCenter; Top := 400; end; [/code] Now the problem I have is the alClient and taCenter work perfectly making … |
| | hi, i would like to check the server datetime when ever my application start. The datetime must be the same with my pc datetime....How do i do that...Is there a way.... i got a code from somewhere but it doesn't work at all...can anyone help me on this.... [CODE]Public Sub … |
| | Hello Friends, How to find Lines of Code in VS 2010? Regards, Simran Kaur |
| | hi all. plz i need help , idon't know how to solve it if anybody help me and to discuss to me how can i write it in assembly program , and this is the question: ================ Write an assembly program that reads Quantity and Unit price as a string … |
| | Hi, I have two files: File1 (tab-delimited and two columns): Ex_efxb 0.0023 MSeef 2.3000 F_ecjc 0.3338 MWEEI -0.111 DDAIij 17.777 File2: MSeef 2.3000 F_ecjc 0.3338 I want to search the content of File one using the content of File 2 and then display the output as follows: Date of search: … |
| | A company pays its salespeople on a commission basis. The salespeople receive $200 per week, plus 9% of their gross sales for that week. For example, a salesperson who grosses $5000 in sales in a week receives $200 plus 9% of $5000, or a total of $650. Develop a console … |
| | Hi all, How i can split a string that include spaces by "&" ? I already used split function but there are problem with spaces. thanks. |
| | This is my first foray into the world of programming. I'm doing a practice project for the consulting firm I work for, and my current objective is to make my submission page textboxes insert the user input into specific tables in my database. Later I'll need to retrieve the data, …  |
| | I am writing a program that requires toggling between 2 forms. I thought I could use the Hide and Show methods but I need a way for the forms to know about each other so they can Hide themselves and Show the other form. Initially, form1 instantiates form2 |
| | [CODE]#include <stdio.h> cant figure it out, im trying to count all digits please help with this bugs int main() { int iochar, numdigits=0, numlower=0, numupper=0, numwhites=0; printf("Please enter a phrase:\n\n"); while((iochar=getchar())!=EOF) { if ((iochar='\o ')||(iochar='\t')||(iochar='\n')) { numwhites++; putchar(iochar); } else if((iochar>='0')&&(iochar<='9')) { numdigits++; putchar(iochar); } else if(('a'<=iochar)&&(iochar<='z')) { numlower++; putchar(iochar-32); … |
| | When you do something like [code] cmp eax,ebx ja start;jump if above start: [/code] Jump if above jumps if eax is greater or if ebx is greater?  |
| | Hi folks, I have googled around, read a lot and still can't figure it out. I know a bit of C++, but am far from literate in all commands. I am much happier with QBasic (old i know, but it works). I have made qb code and need to convert …  |
| | after finishing books of thinking in c++ vol1 and voL2 , ı decided to read c++ programming language 3rd edition by stroustrup. Do you think that it is appropriate?  |
| | Can someone help me figure out what I am doing wrong here. I think I may be running my head into this way to many times to see what is wrong with it. The error code is posted below. [CODE] import java.util.Scanner; public class userName { /** * @param args … |
| | my problem comes up with the code is creating an envelope it keeps saying that envelope can not be resolved to a variable any idea on how to fix this? [CODE]import java.io.*; import java.net.*; import java.awt.*; import java.awt.event.*; /* $Id: MailClient.java,v 1.7 1999/07/22 12:07:30 kangasha Exp $ */ * A …  |
 | I have this code, when run, it is terribly unorganized. It looks like this: [Label Here] [Button Here] [-----TextField Here ----] [invisible Label][Button] my program does this: when something is entered in the JTextField and then you click the [Button Here] then it prints what you printed in the [invisible … |
| | Hey everyone. I am attempting to create a simple console maze generator in C++ for a school project. I've already gotten most of it down but I'm having a problem debugging the actual generation algorithm I've implemented. I've been learning C++ for the past few months now but I haven't … |
| | Hi all I have made a website for a client, a little like a small forum. There are these inputs when starting a new thread: Headline URL Content In the URL they can type only letters numbers and a "-". So that their threads URL can be like [url]http://www.something.com/show/this-is-my-thread[/url] But … |
| | hey i have a problem with a code that i cant figure out what it is im "fresh meat" in assembly so might be a few things what i tried to do is 1) open rnd.txt(65kb) file as read/write ( dump.exe it and you get hex numbers on dos) 2) … |
| | I have a reg text box and just want to add the save command, I managed to figure out how to do open but save is giving me problems. I am fairly new at VB.net been coding less then a week so I need all the help you can give … |
 | I dont have any idea what the problem is. But what I know is it stopped at fgets(temp, 256, stdin); when I run the program, it runs this line and then just stopped because of a segmentation fault. The silly printfs are just for me checking where it stopped exactly. … |
The End.