15,406 Topics

Member Avatar for
Member Avatar for danholding

input [CODE=python]import math print(repr(math.pi)) print(str(math.pi)) [/CODE] output [CODE=python]3.141592653589793 3.141592653589793[/CODE] could someone please tell me what the difference between [CODE=python]repr[/CODE] and [CODE=python]str[/CODE] is as the example on the documentation does not help as they both return the same figure? surely it does something more complex?

Member Avatar for vegaseat
0
1K
Member Avatar for jacksparrow01

how wud you write a code that wud convert a string of any input into a cool X formation for example if you had a string "names" how would you write it in the formation: [CODE][I]n n a a m e e s s[/I][/CODE] Or for example if you had …

Member Avatar for jacksparrow01
0
172
Member Avatar for e-papa

Please I downloaded the latest version of python QT but I've been unable to use because i don't know how, help from the experts in the house. Thanks in advance

Member Avatar for e-papa
1
882
Member Avatar for e-papa

It solves quadratic equations, for both real and complex roots. Please answer the pol to let me know how I'm doing. This function just needs the python 3.x environment, no modules needed.

Member Avatar for e-papa
0
4K
Member Avatar for ThePythonNoob

(Python code 3.0) I have been trying to make it that when you the number it will loop around, I tried this: If guess==num: #this is randomly generated number ask for yes or no the playagain if answer==yes replay=1 play_guess==0 if replay=1 play=("yes") however this does not work, please could …

Member Avatar for richieking
0
123
Member Avatar for Jerix

Hey, I'm trying to write a program right now with the following requirements: 1. Read a CSV file for field ID#. 2. Compare it to a second CSV file for the same ID # 3. If Csv1ID == Csv2ID, write the rows from both files to outputfile. So basically I …

Member Avatar for TrustyTony
0
506
Member Avatar for parijat24

Hi , I have interesting problem as I have a file 'A' which looks like [CODE]>BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]105[/COLOR] 136 [B]Ank[/B] [COLOR="red"]NGCTPLHYAASKDRYEIALMLLENGADPNATD[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]141[/COLOR] 169 [B]Ank [/B] [COLOR="red"]TPLHRASAKGNYRLIQLLLRQSASTNIQD[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"]172 [/COLOR] 202 [B]Ank [/B] [COLOR="Red"]GNTPLHLACDEERVEAAKLLVEHGASIYIEN[/COLOR] >BIG_CLUSTER96 ENSTNIP00000002777 TETRAODON8 1 [COLOR="Green"] 40 [/COLOR] 71 …

Member Avatar for TrustyTony
0
196
Member Avatar for e-papa

I tried to find the square root of a negative number while writing a function to solve quadratic equations but the interpreter said something , it said math domain error, what does this mean. Even though I've been able to solve the quadratic equation using complex numbers and i will …

Member Avatar for e-papa
0
19K
Member Avatar for bioplanet

Hi all, I have the following script for creating scatter plots and I was wondering if there is a way of adding the legends also for each dot in the plot (i.e. Method1, Method2 etc) [code] #!/usr/bin/env python import sys,re,os; import matplotlib as mpl; import matplotlib.pyplot as plt; datafile = …

0
105
Member Avatar for Ephexeve

I've been looking for an exercise book for Python, a book that we get some stuff to code, like ideas, and etc. I have already finished the "Invent your own computer games with Python". Is there any other book? Thanks in advance.

Member Avatar for Ephexeve
0
229
Member Avatar for vbx_wx

I want to open a process in the background and it should be invisible in both Linux and Windows. I made something like this, but I don't know the console still appears on the screen: [code] command = "cmd /C dir c:\\" startupinfo = None if os.name == 'nt': startupinfo …

0
57
Member Avatar for mang0

I just recently (one week ago) started learning Pyton. I'm using 2.7 as I heard that is best for begginers. I am also following a manual, which is really helpful! The one problem with manuals is that it's very easy to just type whats written and not understand it at …

Member Avatar for e-papa
1
161
Member Avatar for e-papa

Well just run, the only thing is that this is created using python 3.x. no modules required.

Member Avatar for e-papa
0
731
Member Avatar for e-papa

Is python 3.2 stable yet, because i use portable python v1.1py3.0.1, so far I'm making improvement, but I have problems loading modules, how do I go about it.

Member Avatar for e-papa
0
932
Member Avatar for e-papa

Please i just downloaded the latest version of pygame, but I've been finding it difficult to install, okay when i unpacked it, everything came up, but i don't know which should go to which. Python experts in the house what do i do.

Member Avatar for e-papa
0
179
Member Avatar for joeywheels

I'm trying to create a vertical histogram using only built-in modules. I understand the current histogram function isn't truly a histogram (and the code is probably very ugly), but I'm totally lost on how to create a vertical histogram. [CODE]import itertools def histogram(s): print("Histogram:") print("%s %7s %12s" % ( "No.", …

Member Avatar for TrustyTony
0
1K
Member Avatar for sbiren

[CODE]def main(): i=input() print(i+1)[/CODE] (I use PYTHON 3.2) Why i get an error converting message ?

Member Avatar for richieking
0
176
Member Avatar for coconutdumplin

Hi guys this is my very first python program I've been trying to use re.match to test to see if a string is an identifier as defined by this syntax [CODE]identifier -> letter{ letter| digit}[/CODE] I tried the following statements but when i test my program every single time it …

Member Avatar for coconutdumplin
0
117
Member Avatar for Simplified

Hello all I'm having a few issues with a Python program in that I am performing decimal calculations on and most values come up as desired, however every so often, when there is a very small decimal, the number is represented like "6.80E-7" rather than the desired "0.000000680". Here's a …

Member Avatar for Simplified
0
216
Member Avatar for jordan0420

i am currently running Mac OS 10.5 and i have written and fully debugged (nothing in the command line) a large python script. i am wondering how am i able to create an app for the program. i do not understand the lingo of how to install different libraries and …

Member Avatar for e-papa
0
131
Member Avatar for xleon

[CODE]from Tkinter import * master = Tk() def ChangeOpt1(): Options.option_clear() Options.option_add("Apple","Orange","Melon") Options.update() def ChangeOpt2(): Options.option_clear() Options.option_add("Milk","Water","Juice") Options.update() Option1=Checkbutton(text="OPTION1",indicatoron=0,command=ChangeOpt1) Option1.pack() Option2=Checkbutton(text="OPTION2",indicatoron=0,command=ChangeOpt2) Option2.pack() variable = StringVar(master) variable.set("You have to check an option") Options= OptionMenu(master, variable, "You have to check an option") Options.pack() mainloop()[/CODE] I want to do that when I clicked Option1, …

Member Avatar for xleon
0
4K
Member Avatar for Voidz

Hi DW, I'm extremely new to DaniWeb. I have been coding in C++ for about one month. I'm thinking about coding in Python too. But, I'd like to ask some newbie question's about it first. [B]I'd like to know what it's used for.[/B] [I]I think it's mostly used for web …

Member Avatar for e-papa
0
280
Member Avatar for e-papa

[CODE]#this function checks if a number is a prime number, #if not it outputs the lowest factor. def isprime(n): """Determines whether a number is a Prime number, Takes a single arguement n, which is the number""" if n==1: return 'Not a Prime number, only has one distinct factor' elif n==2: …

Member Avatar for e-papa
0
221
Member Avatar for dustbunny000

I have this code: [CODE]protein="GWEIQPYVWDECYRVFYEQLNEEHKKIFKGIFDCIRDNSAPNLATLVRVTTNHFTHEQAMMDAVKFSEVLPHKKMHRDFLEKLGGLSAPVDNHIKGTDFKYKGKAKNVDYCKEWLVL" pp="LLCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHCLLLCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCL" gor="cccccccccccchhhhhhhhhhhhhhhhhhhhhhhccccccccceeeeecccccchhhhhhhhhhhcccchhhhhhhhhhhhhccccccccccccccccccccccceeceeccceec" aber="CCCCCCCCCCCCHHHHHHHCCHHHCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC" for i in range(len(protein)): print i+1,protein[i], pp[i], gor[i], aber[i] [/CODE] I'm trying to compare these strings. However, the output is in a vertical format. How can I print it so that the format is vertical? This would make it much easier to …

Member Avatar for jice
0
232
Member Avatar for e-papa

This is a program that can calculate, the GPA of a student on a 5.0 scale,it's written in python 3.x and no modules are required.

Member Avatar for TrustyTony
0
6K
Member Avatar for dos_killer

i am tryin to create an app that should make my cellphone work as a webcam ... there are softwres like smart cam for that... also there is an app like mycam that lets you use a gif and create a vistual cam ... i want to know how an …

Member Avatar for dos_killer
0
109
Member Avatar for khaos64

I had recently made a .bat file that read a couple lines from file.txt and assigned them as variables then went through the execution of the bat which ended up deleting the original file.txt and writing the new values to a new file.txt. Now I want to convert this to …

0
121
Member Avatar for banannamoofin

I am currently having problems displaying a file correctly once i have written a dictionary to the file. For this program the input file needs to have the format: ID: Date: Dayskept: ProductName e.g. 1:12/12/2011:12:A This is fine the first time I read the example file into a dictionary, but …

Member Avatar for TrustyTony
0
213
Member Avatar for elbib84

hi, am trying to parse a multiple pairwise format into table for example: Query= m100529_140129_SMRT1_c0000010190006406181231110_s0_p0/32965/0_332_clipped_50:0 (282 letters) Query: 8 TTTTTGAACAGCCCCAACAACTCTTCCGCTGCCGGTTGCTGCA-TTCCAGTTGTTCCACA 66 ||||||||||||||||||||||||||||||||||||||||||| |||||||||||| ||| Sbjct: 4045830 TTTTTGAACAGCCCCAACAACTCTTCCGCTGCCGGTTGCTGCACTTCCAGTTGTTC-ACA 4045772 Query: 67 GTCCAGCTCCAGTTCAACGTCGGTTTAAATCGTCG--AGCT-GTATGAGAGATAAGCATA 123 | ||||||||||||||||||||||| |||||||| |||| |||||||||||||||| | Sbjct: 4045771 GGTCAGCTCCAGTTCAACGTCGGTTTTAATCGTCGCCAGCTGGTATGAGAGATAAGCA-A 4045713 Query= m100529_140129_SMRT1_c0000010190006406181231110_s0_p0/56521/6_684_clipped_527:0 (151 letters) Query: 1 CTTCAAAGAGGGAGAATTACGTCGATATTACCGAAGGCTGGGAGAAGGGTGAAAATACAA 60 …

Member Avatar for griswolf
0
151
Member Avatar for bwbyron

Obviously, here is the initial code for this blackjack game. and in order for me to feel confident in this game I need to have an error check to make sure that there are at least 7 cards per player. And I have to do this in the second part …

Member Avatar for woooee
0
320
Member Avatar for alokdhari

My tutor suggested me to use deep copy for copying tuples for pawn-chess game... can anyone help me out with how actually deep copy works ?? coz if i know it i can work it out in a more smoother way... n yea... m new to python !!

Member Avatar for alokdhari
0
211
Member Avatar for vegaseat

Crypting with xor allows one to write one function that can encrypt and decrypt a file. In this example a text file is used, but it could be an image file as well. Once you have created the encrypted file you simply send it through the same function again to …

Member Avatar for TrustyTony
3
7K
Member Avatar for e-papa

[CODE]file=open(words.txt) print(file)[/CODE] Please Ive been trying to use the open() function to open a txt file in python, but it keeps telling me that there is no such file or directory, where should I put the file for me to be able to import it. HINT: I use pyscripter, but …

Member Avatar for e-papa
0
180
Member Avatar for lucksoar

Hello, I was curious to know if there was some way to change a .py file to a .pbp file. I know that I can easily make an .exe file with py2exe, is there something like that for pbp?

Member Avatar for TrustyTony
0
288
Member Avatar for ihatehippies

Anyone work with UltimateListCtrl's before? I'm looking for a way to dynamically change the column headers background color.

0
109
Member Avatar for rssk

hi all... i want to upload a file using ftp path1 = "D:\Python\test" host = sys.argv[1] def main(): try: f = ftplib.FTP(host) except (socket.error ,socket.gaierror),e: logging.info("Error: cannot reach '%s',%s" % (host,e)) return logging.info("***connected to host '%s'***" % host) try: f.login(user="root",passwd="aims") except ftplib.error_perm: logging.info("Error :cannot login ") f.quit() return logging.info("***logged in …

Member Avatar for richieking
0
545
Member Avatar for spe_eddy

I can't work out why when i try to print the list(listProb....s) it prints the empty list, i'm not setting them to the empty list after this code or anything, and when i print the normDistProb's on their own it prints fine): [CODE]for i in range(0,12): listProbFog.append(normDistProb(dayValues[i], fogAve[i], fogVar[i])) listProbSnow.append(normDistPr...ob(dayValues[i], …

Member Avatar for TrustyTony
0
182
Member Avatar for Echo_2011

Hello All Thanks for such a informative web site. I'm a newbie to python and using python 2.6 for few weeks with no problem. I love notepad++ and trying to hook it up with python2.6 as explain in here but I can't. In notepadd++ at Run menu I get to …

Member Avatar for e-papa
0
1K
Member Avatar for Atistus

I am quite new to Python programming, just started about a week ago, and was just designing a simple menu for a simple guessing game. I have browsed Google and other websites trying to find snippets of code that may help me but my searches haven't turned up anything. I've …

Member Avatar for Atistus
0
176
Member Avatar for ThePythonNoob

It will carry on if the input is X but not O!! block of code concerning this matter [code] print("\nWould you like be X's or O's ? <O/X>:") human=["",""] while not (("X") or ("O")) in human[0]: human[0]=input("") [/code] whole code: [code] print("Welcome to the greatest intelletual challenge of all time: …

Member Avatar for ThePythonNoob
0
102
Member Avatar for shawntheking

Create a game where the computer picks a random word and the player has to guess that word. The computer tells the player how many letters are in the word. Then the player gets five chances to ask whether or not a specific letter is in that word. The computer …

Member Avatar for TrustyTony
0
118
Member Avatar for MASTERofMINDS

Hi, I want to get a link from a webpage say h++p://www.daniweb.com. This page might be aspx. Then I want to extract a particular url from this and I have to open that url with some parameters. What should I use for this for doing this in python?? Just need …

Member Avatar for snippsat
0
140
Member Avatar for markmcwiggins

I am working on a psycopg2 application for a customer. I first used: SELECT * from table which worked fine with 'cursor.fetchone()'. But due to some technical details between the customer's database and the database on my company's side where I could not depend on the order of the fields, …

Member Avatar for markmcwiggins
0
164
Member Avatar for Shansal

Hi, I created successfully an .exe file for my python code. As a .py file, it works like a charm. But when I try to run it from the exe version, I get error as follows: [CODE] Traceback (most recent call last): File "CreateAS.pyw", line 14, in <module> File "pulp\__init__.pyc", …

0
52
Member Avatar for lucksoar

I know that many people have programed for the Ipod, and have used a lot of different languages, but I can't figure out how to use python to make apps. I understand that I need an interpreter, but I don't know where to find one. Also, how do I import …

Member Avatar for lucksoar
0
255
Member Avatar for Thropian

I was wondering if there is a way to make a transparent image for Tkinter. I was wanting to layer some images at random so I wouldn't know the background to use... at first I was using .GIF but I heard .PNG worked for transparency but I couldn't get .PNG …

Member Avatar for Thropian
0
27K
Member Avatar for Thropian

I'm trying to make the old box game (if you are unfamiliar with it you can play it here: [url]http://www.tcastle.com/games/dots/dots.html[/url] I've seen it go by many different names though) and I was wondering if there was a way to get the pictures on buttons to change easily this is the …

Member Avatar for Thropian
0
126
Member Avatar for ThePythonNoob

I cant figure out how to make a input lock that if the user types in a letter and not a number between 0 and 1000 that it will keep on asking for a number until it gets it. Thanks for any help.

Member Avatar for bumsfeld
0
172
Member Avatar for doomas10

Hello, i have the following query. I have a txt file with data like this: [CODE]1 observational study 1.1 cohort study 1.1.1 retrospective cohort study 1.1.2 prospective cohort study 1.2 cross-sectional study[/CODE] And another file with data like this: [CODE]cross-sectional survey 12345.txt retrospective study 2345.txt ...[/CODE] I want to do …

Member Avatar for TrustyTony
0
229
Member Avatar for manofhouse

The program is suppose to create and account but if the passwords do not match after the 3rd iteration it's suppose to output that its been too many tries and end the program... I can't seem to figure this out any help would be greatly appreciated. [CODE]while 3: print ("Welcome …

Member Avatar for manofhouse
0
176

The End.