15,406 Topics
 | |
| | Hello, I am currently trying to learn programming and am using Python to start with. I am currently practicing programming with classes and have placed the following code into a python file called complex.py: [CODE]class Complex def __init__(self, realpart, imagpart): self.r = realpart self.i = imagpart[/CODE] and placed the following …  |
| | I have 2 images, one is supposed to be on top of the other. This works fine until one of the "movement" keys are hit (a,s,d,w) [CODE]import sqlite3 as sqlite import wx username=None class MainWindow(): def drawmap(self): self.map4_31="C:/python27/game/4_31.gif" self.map1=wx.Image(self.map4_31,wx.BITMAP_TYPE_GIF).ConvertToBitmap() height=self.map1.GetHeight() width=self.map1.GetWidth() self.map1.map4_31 = wx.StaticBitmap(frame, -1, self.map1, (270, 170), (width,height)) def … |
| | Basically, it is an open source software creation application that revolves around databases (similar to Microsoft Visual studio in some aspects but with python as the language). The user will be able to create forms with a drag and drop GUI builder, create an SQLite database and add functionality to … |
| | So, I'm trying to assign some SQL to a variable which will later be executed in the code. I also want to include a varible inside the SQL. I am only allowed to code over 80 characters and then I have been told to use a black slash, now this … |
| | [code] def main(): decimal=int(input('pleas enter a binary sequence: ')) number=binaryConvert(decimal) print("Contert to decimal: ", number) def binaryConvert(decimal): if decimal == 0 : return '0' elif decimal==1: return '1' number='' while decimal == '1' and decimal == '0' : number=str(decimal%2)+ number number=number main() [/code] but i did work well with me … |
| | Anyone ever used the PIL (Python Image Library)? If you have, is there anyway to convert a single pixel at a time in a bmp file? I'm trying to invert a black and white image to white and black. So: [code=python] import PIL image = Image open(filename) pixels = list(image.getdata()) … |
| | (question3.py) Write a word jumble game. In a word jumble the letters in a proper word are randomly mixed up and the user has to guess what the word is. The list of words to be jumbled can be found on D2L - jumble.txt. Here is one possible way to …  |
| | Hello everyone, I managed to recieve the contents of my email from gmail using the poplib module. But I am nor able to save these emails. How can I save the contents of email including images etc in most preferably in a html file?? Regards BattleX |
| | Hi, I'm trying to convert a textfile which is set out like this: 1[Tab]Hello 2[Tab]Test into a Python dictionary how would I be able to do it? Thanks |
| | Hello, so I've been working on a simple Tic Tac Toe game using TKinter graphics GUI. However i keep getting this error, and i'm not sure why. Any help would be greatly appreciated. Heres the code [CODE] import graphics import random def constructBoard(): win=graphics.GraphWin("Tic Tac Toe",500,500) win.setCoords(0.0,0.0,3.0,3.0) line1=graphics.Line(graphics.Point(1,0), graphics.Point(1,3)).draw(win) line2=graphics.Line(graphics.Point(2,0), … |
| | I want to compare a list of files with extension .rtf in my directory with a list of files at a given url and download the files at the url not found in my directory. This is where I am at but cannot figure how to filter a list based … |
| | This I did also after 'spying' discussions in other forum. Of course you would use sieve prime generation for bigger numbers, but I proved other simple way for a change. Slightly more advanced primes list generator would use primes % 6 in (1,5) property: [CODE]def primes(n): """ primitive non-sieve prime … |
| | I'm working on a script in python,tkinter that draws a triangle and moves it around the screen. unfortunately I can't get the arrow to move. I've tried using canvas.move() but that wants an x and a y not the set of 3 coordinates I have to make it a triangle. … |
| | I need help. I am very illiterate in Python and the like and I have a chunk of code that checks to see if a page updates and then posts it onto a forum. I need to alter it (hopefully) to check to see if an RRS feed is updated … |
| | [code]def cDownload(): print("Enter package name ") sName=input print("Enter download location ") sLocation=input command = "wget http://aur.archlinux.org/packages/" + sName + "/" + sName + ".tar.gz -O" + sLocation + "/" + sName + ".tar.gz" os.system(command) [/code] I get TypeError: Can't convert 'builtin_function_or_method' object to str implicitly |
| | ok someone please explain popen to me it runs subproccesses does this mean it can run programs from within my program? any help would be appreciated , there is not an easily spottable place that explains this. Thanks  |
| | It seems like dataRecived is not "firing" but I cannot work out why. Any ideas? Thanks [CODE] # Basic Chat Server # Imports from twisted.internet import protocol, reactor import pickle import string PORT = 6661 connections = [] class User(protocol.Protocol): def connectionMade(self): self.transport.write("Welcome") def dataRecieved(self, data): print data def connectionLost(self, … |
| | Hi, Gribouillis, helped me to understand how to invoke a function by btn click event handler, at my last post.Now I am trying to understand how I can handle an selected item event from a list box? lets say I have a list box like below and I want to …  |
| | Hi there, I'm kind of new to python and I'm trying to extract a protein sequence from this webpage... [url]http://www.ncbi.nlm.nih.gov/protein/BAH23558.1[/url] When I use urllib.urlopen the html it gets does not contain the sequence data. When I open this page in firefox and use firebug to look at the page I … |
| | Hello all, i was working on an R script that will read a huge text file and make some calculation inside it, but i figured out that it will need long time to do the job , so i'm trying to convert it into python. is there any way to … |
| | I have a string that looks like: IiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi I want to to capture all the segments that have H's in them and return their respective start & stop string positions. [CODE] tms = re.compile("H+") print tms.findall(string) [/CODE] This will find all the Hs but I cant get the string positions … |
| | I've tried to make the code below to solve one of the Euler equation for the Gas Dynamics. I understand my code is not perfect, that is why I'm getting an error which I don't understand. The error message is: " File "eulersys.py", line 50, in <module> u_data = Evolve_in_One_Timestep(u_data) … |
| | So, I found a snipped of code that did what I was looking for but I tried adding upon it to fit my need a little more. What I am trying to do is input an integer and return an 8 bit binary string to a list. My first problem … |
| | I am trying to delete a cookie by reseting it but it wont delete. What am i doing wrong [CODE]#!/usr/bin/python import cgi import Cookie import os def cookie_expiry_date(numdays): from datetime import date, timedelta new = date.today() + timedelta(days = numdays) return new.strftime("%a, %d-%b-%Y 23:59:59 GMT") print 'Set-Cookie: UserID=0; expires= '+cookie_expiry_date(-100); … |
| | I am looking for step by step details of how to deploy django websites in apache2 server with one example. I am using ubuntu operating system Please give some link or give the details. |
 | Hello friends, I want to write simple script to download youtube videos, but I have problem... I use One-liner for this, the file is downloaded but it's empty (0 bytes). Can someone help me about my problem ? Here is my code: [CODE=python] # Author: Abhinay Omkar # Title: One-liner … |
| | I believe the Python thread is the most appropriate place to post a Django question :P Hi there guys and girls! I am currently busy (and learning) Django. It really is a solid platform to work on compared to PHP. Ok let me get to the point :P I am … |
| | I don't know if you could fix this code.. but there is something wrong with it or with me.. i don't know which.. here is the code for the .py script [CODE]import string import sys # input if len(sys.argv) < 2: print "Not enough arguments, quitting." quit() if len(sys.argv) > … |
| | I literally hate to ask this question but I am having trouble with Qt 4 basically all I am trying to do is clear the textEdit area with clear() but I am not sure of what to do. In C++ I would just [CODE]textEdit->clear();[/CODE] and it would do so. I … |
| | Can someone please show me the best way to achieve this with the least amount of lines? Im a recovering PHP coder, I have one solution. I was wondering if there was a quicker more pythony way to do this: I have in "results" [ICODE][('Basp1', 'Aen2'), ('Basp1', 'Ahy18'), ('Basp1', 'Ahy26'), … |
| | hi all i hav a list like list = ['0', '344', '1', '345', '2', '346', '3', '347', '4', '348', '5', '349', '6', '350', '7', '351', '8', '352', '9', '353', '10', '354', '11', '355', '12', '356', '13', '357', '14', '358', '15', '359', '16', '360', '17', '361', '18', '512', '19', '513', '20', … |
| | This is my class project to be made in pythonCard : A local community centre desires to have a user friendly application to keep track of their community members. The application must allow a user to display information about community members, including the list of activities that individual members are … |
| | hello, small question if i may :-) [CODE] try: x=int(input()) except ValueError as var: print(str(var.args[0])) [/CODE] if i input a string like - abcd this code prints me the full error message invalid literal for int() with base 10: 'abcd' while i need only the input - abcd to be … |
| | How do I call a batch file in jython? thanks!! |
| | Hey everybody. All my Google searches for help led me here so I thought I'd post my actual problem directly. I'm in a 101 programming course and this is only our second Python assignment. What I need to do is use one-dimensional parallel arrays to allow input of four different … |
| | The problem is that I want login to a remote pc using ssh through a python script. I don't want to use any ssh-keys (rsa keys,dsa keys etc.) nor do I want to use some extra module not incorporated in python standard libraries (telnet etc I guessed it is used … |
| | Hi, I got the cxfreeze working on the Mac OS X 10.6.7 and the distilled Python script runs fine on that Mac Book. Now I'm getting reports from Mac user clients that it doesn't work for them. It is a simple script that only calls from the Mac it's terminal. … |
| | Hi, Is there a way to get the full path of my war file in jython?? I have war file (myApp.war) that is stored in D:\myConstantDirectory\myApp.war I want to create a jython script that can retrieve the full path of my war file by just specifying search myApp.war and it … |
| | I have made a very simple dice game, How can i output the results of the dice using this format. Thanks for your time. [CODE] ========== | 0 | | | | 0 | ========== ========== | 0 0 | | 0 0 | | 0 0 | ========== [/CODE] …  |
| | Hey guys, I hate asking this but unfortunetly, Google does not know how to interpret "|" and probably assumes its an OR command or something :P . The line goes as follows (source found [URL="http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html"]http://pysnippet.blogspot.com/2009/11/fuse-filesystem-in-userspace-part-1.html[/URL] here): [CODE]st.st_mode = stat.S_IFDIR | 0755[/CODE] I know it's doing something about the mode being … |
| | I get this python error: unindent does not match any outer indentation level, and a red bar appears where "RIGHT HERE RED" is.., keep in mind that this is just a fraction of the entire program but i dont know where the spacing error occurs... pleeeaaase i beg you and … |
 | Hi all, Here is a part of my code: [CODE]#-- if the ports are mapped properly if(map_dict1[int(MIO_outports1[i])] == int(Exp_map_inport[i]) ): flag = 1 elif(map_dict2[int(MIO_outports1[i])] == int(Exp_map_inport[i])): flag = 1 else: flag = 0 [/CODE] But I am not able to navigate to the 'elif' part. I am getting : [CODE] … |
| | Hi! I have a batch file (potchi.bat) that contains the lines ... set maxHeap = 2048 set initialHeap = 512 set mydir=%cd% ... and I want to pass these values to a jython script (myScript.py) such that fullpath = '%cd%/myApp.war' AdminApp.installInteractive(fullpath, -contextroot myApp) AdminTask.setJVMMaxHeapSize('[-serverName myServer -nodeName myNode -maximumHeapSize %maxHeap%]') AdminTask.setJVMInitialHeapSize('[-serverName … |
| | hi guy just started python, i have a text here and want wo find the number of each letters, and sort the number from the most frequent to the least frequent. hope you guys can hepe me here is the text, just some random letters, acbbmnhctrgnmmxfnfbmqrhnchfwcqwtacvtfhmecttvfcnvphchmpgdmebjdcqwhdfnfrcawhdfrkanahtcjaqxahpkmqdardfcnhcqwjmprdcttvfpkdftwaqbmnfhdcqhdarcrhdfzmnwrzfnfrkmsfqhdfjkcrrfwhdnmpxdhdfzcttcqwrhmmwpkmqcqmkfqgmpqhnjnmcwzahdeaftwrmqfahdfndcqwhdfgahjdcwfqhanftjlcqardfwqmhclfrhaxfmeahzcrhmvfrffqhdfwcnsqfrrcqwhdfbarhdcwlcqardfwzahdahemnahzcrcgtfcngmtwzaqhfnwcjzahdrqmzpkmqhdfxnmpqwxmmwdfclfqrcawrgnmmxfgtcrkaqxdar |
| | This is hopefully example of properly tested code snippet (fingers crossed). |
| | write a python program , which takes one argument ,which is a word( as a string), and returns "true" if the word contains alternating vowels and consonants(i.e a consonant , followed by a vowel , followed by a consonant ....). Then write a short piece of code to read the … |
 | I have a lot more code than I'm going to post here, but I am posting the relevant parts. What I have is a Calculator program. Here's the code: [CODE=Python] num1 = None num2 = None oper = None def calculate(num1, num2, oper): print("calculate() called") if(oper=="+"): answ = Decimal(num1) + … |
 | Hi all, I'm trying to use Python's urllib to get a Facebook profile page. I get the following error: [CODE]IOError: [Errno socket error] [Errno 10035] A non-blocking socket operation could not be completed immediately[/CODE] Here's my code: [CODE] import urllib member_profile_text = urllib.urlopen('http://www.facebook.com/profile.php?id=1073109649').read() [/CODE] I need to get this working … |
| | [I]This is one idea for thread of some lessons learned with experience about asking wrong question and answers 'thinking out of box'. If there is need to have sticky, I suggest that this thread become sticky development thread and moderator can move the upvoted suggestions for next part in new … |
| | Ive noticed print() includes linebreaks, and its real easy to suppress them. Is there a way I can write lines to a file, but have the line breaks includes implicitly? eg: [CODE] file=open("testfile.txt","w") file.write("line 1") file.write("line 2") file.write("line 3") file.close() [/CODE] meanwhile the file will contain [code] line 1\nline 2\nline … |
The End.