199,114 Archived Topics
Remove Filter  | |
| | i am trying to merg two linked list. error occurs when i run the program it dead. i believe it is because the function i defined to merge these two list has problems would someone helpe me to fix it or some hint would be nice thanks[code]#include <stdio.h> #include<malloc.h> typedef … |
 | Hello all, I am in need of a dll that, if passed the shortcut/.lnk name and the Start Menu -> Programs path if needed, will return the target attribute of that shortcut. I am going to be calling this from a Lua script based application from Indigo Rose called AutoPlay … |
| | I'm trying to create a simple network with perceptions and it doesn't seem to be working. I was wondering if someone could correct my mistakes. Thanks! [CODE]#include<iostream> #include<cstdlib> using namespace std; int pWeights[] = {0,0}; int Classify(int pInput, int pThreshold, int i, int Bias){ int classOut; if( pInput*pWeights[i] + Bias … |
 | Hi I want to compile py files to com files. Please help me. thanks.  |
| | hi to everyone :) [CODE] If c >= 17 Then PictureBox17.Location = PictureBox16.Location End If If c >= 16 Then PictureBox16.Location = PictureBox15.Location End If If c >= 15 Then PictureBox15.Location = PictureBox14.Location End If If c >= 14 Then PictureBox14.Location = PictureBox13.Location End If If c >= 13 Then … |
| | How can I fix this so it will let me compare the two? note, the error is at the for loop. [CODE]string Socket::Recv() { /* Get socket size before recv'ing */ while (size == 0) ioctlsocket(client, FIONREAD, &size); /* Create a 'string (characters)' the size of the information being recv … |
| | Hello... I'm having a real hard time with displaying the proper data in Project Summary. First off, I am using an Access database to bring in the data. Total hours are being calculated correctly. Rates are as well. I tested using a messagebox to make sure the rates are being … |
| | Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … |
| | We are creating a Who wants to be a millionaire style game in VB. Our server is pulling information such as questions and answers from a Access Database and sending them to the contestants (Clients). All transfer of information is directly from the server to each client. One of the … |
| | Im trying to make a bac calculator and make a gui for it but am having issues with the math code for it. Here's my code. Everything I input returns 0. The BAC forumula is (150/body weight)(% alcohol/50)(ounces consumed)(0.025). Btw, I suck at math so it could be a math … |
| | Ok guys, I've kind of got this file half way working, but I get this message: [B]Notice: Undefined index:[/B] uploadedfile on line whatever. along with this: The file has been uploaded. which is the good part. But I don't understand why I always get those undefined errors. [CODE]$uploaded_size =''; $uploaded_type … |
| | I'm trying to find the product of two numbers using a function which receives the values of two variables from main() and the address of the variable prd where the product will be stored. I can't get this compiling because i get the following errors from Visual Studio C++ 2010 … |
| | Hello-- Inside of a header file (Point.h), I've created a class template. I need to override the addition operator as shown below, so what I have done is declared it as a [I]friend[/I]. However, when I try to access the private member variable [I]std::vector<T>coord[/I] from within the body of the … |
| | Hi. I know my description wasn't good but let me try to explain what I want to do. I have two tables on a page, both are inside of iframes (because i need scrolling) table one is filled with day, date, story, and chapter info for a set of stories. … |
| | hello all! i try to deactive my plugin,it's just show this message: Warning: Cannot modify header information - headers already sent by (output started at C:\xampp\htdocs\Phone_Shop004_wordpress\wordpress\wp-content\plugins\gallery_ffic4hotel\gallery_hotel.php:1) in C:\xampp\htdocs\Phone_Shop004_wordpress\wordpress\wp-includes\pluggable.php on line 868 .please anyone help! |
| | hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] …  |
| | I need to do the following program, but it need to have a do while loop, scanner for input, and a console program. Here are the instructions: Write a Java program that prompts the user for how many individuals they will be entering. Then program will then prompts for each …  |
| | I am using scipy distribution scipy-0.4.9.win32-py2.4.exe with python 2.4 on Windows XP. When I try to import scipy I get the following error. [code] Traceback (most recent call last): File "<pyshell#4>", line 1, in ? from scipy import * File "D:\Python24\lib\site-packages\scipy\__init__.py", line 33, in ? del lib NameError: name 'lib' … |
| | hi, I am a new member here i hope that found some one who can help me in this C++ project I am a novice in C++ and this will be my first code if any one has experience please help me in the algorithm and what should i do … |
| | Hi, I've been trying to capture video from webcam using openCV functions and openGL for rendering. The code is working fine and I can acquire and display both the cameras. Now I'm trying to record the captured video's and saving them to a file using openCV createvideowriter object. I can … |
| | java.awt.*; import javax.swing.*; import java.awt.event.*; class Getaction implements ActionListener{ String am = ""; String req ; String em = ""; String oper = ""; double x,y ,result; String res; Addcomp get = new Addcomp(); public void actionPerformed(ActionEvent ev){ req = ev.getActionCommand(); if((req.equals("1")) ||(req.equals("2"))||(req.equals("3"))||(req.equals("4"))||(req.equals("5")) ||(req.equals("7"))|| (req.equals("8"))||( req.equals("9")) ){ if (oper == … |
| | What a great site! I'm looking fo a hint. I'm new to any type of programming and this C code just doesn't seem to be working. I have attempted a program that gives the ohm value of a resistor when the color code is entered in. I am using an … |
| | hello geys, i have some codes and i tried to find the output for each of them. most of the codes i answered but there are some codes which are strange for me (the output) first, i want from every one is to find the output without test it, please … |
| | hi, I'm using Dreamweaver MX and I've got a problem with 2 pages including repeated zones. I added to these pages a dynamic text, and after this, in test mode I have a parse error at last line of the code. It seemed to me my code was clear. So … |
| | is this possible with php? I have a login script and i need a way to check if the session exists so users can view pictures in the directory |
| | Hi I'm using wamp on my local machine. I have my form and php script made but I'm not sure how to place my folder to recieve the file. ie:[CODE]move_uploaded_file($_FILES['file_that_was_uploaded']['tmp_name'], $_SERVER['DOCUMENT_ROOT'] . '/images/' . $final_filename);[/CODE] I'm not sure how to set my path on the serve for my images folder. … |
| | [CODE]template<class type> struct _binary_search_tree { type key; struct _binary_search_tree* parent; struct _binary_search_tree* left_child; struct _binary_search_tree* right_child; }; template<class type>void tree_insert(_binary_search_tree<type>** tree, type key); int main() { char number[10]; _binary_search_tree<char*> root; tree_insert(&root, number); }[/CODE] [QUOTE]compile error: 755.c:182: error: no matching function for call to ‘tree_insert(_binary_search_tree<char*>*, char [10])’[/QUOTE] Thanks.  |
| | hallo guys.i am newbie at java and i want ur help. i have created the 5 five buttons but not the action listeners for them. the five buttons are : add person, see ll persons, search a person,update a person, delete person.so when i press add person the programm should … |
| | Hi i have some problem with the listview control i dont know how to use it here is what i wanna do [code] sub mysub() handles myEvent for i=0 to 3 Dim lv As ListViewItem = ListView1.Items.Add(x(i)) lv.SubItems.Add(x(i)) lv.subitems.add(x(i)) ... next end sub [/code] so when the next event occurs … |
| | hi guys, im using dreamweaver8, do bear with me I'm a newbie. Im trying to insert multiple rows from a form into the same table in mysql. I mixed some code I saw online with the code generated in dreamweaver and then when I tried running the page I got … |
| | Hey, So I have a small Flash application that plays a sound when a new message is received in a chat-box. The flash player is on a page embeded with an iframe. [CODE=html]<iframe width="1" height="1" frameborder="0" name="alerter" src="/chatbox/flash/alert/sound.php" id="chat_alert"></iframe>[/CODE] In the parent window, a variable called new_message is used to … |
| | Hi! This code should replace <br> or <br /> between certain elements in text posted in textarea element. I use [B]nl2br[/B] for detection of new line. That function also adds <br /> between html elements...for example <table>[COLOR="Red"]<br>[/COLOR]<tr> elements... Code works fine, but... When used multiple column table, code "eats" all … |
| | Web application projects exist on your local drive and are treated like any other VS project type and can be added to existing solutions are subject to full compilation, validation and build steps. Thats what my homework is about, a web application so what am trying to to is to …  |
 | hi i'm pulling data from a mysql database and displaying it in an html table. my problem is i want to be able to have the information broken into pages so that users dont have to scroll down a page but i'm not sure how to do this. thanks |
| | Hi All, I have developed a application in jsp. I need to achieve a count down timer(days,hours,minutes,seconds) between from date to todate, considering below cases. All below are assumed (1) I have 4 product, for each product i have different end date stored in mysql in DB. (2) I need …  |
 | I'm working on an addon system for one of my projects. I'm able to add a new menu item, but the self.Bind(...) is causing me troubles instead of bind the function to the menu-item, it just calls the function. and doesn't bind at all... :s [code=python]self.ID_OPEN=wx.NewId() wxglade_tmp_menu.Append(self.ID_OPEN, eval(menucontent)[i][0], "", eval("wx.ITEM_"+eval(menucontent)[i][1])) … |
| | Hello there. This is my first post in this forum which, by the way, I find outstanding simply because everytime I google a C problem I find an answer here. Ok so, I have a very simple problem. I use Windows 7 and recently had a major problem about my … |
 | Hi, I wrote star voting system for my site using Ajax. You can see it at: [URL snipped] (it is under the game) Besides using it for voting system, what else can I use Ajax for? Where do you use Ajax in your sites? I would really appreciate your answers … |
| | when i click on a submit button it should take me to get.php but it doesn't whats wrong? [CODE] <form enctype='multipart/form-data' action='' method='POST' name='form'> <div id=$counter><input type='submit' name='webpage' value='Add Webpage' onClick='return changeAction1(this);' /></div> </form> [/CODE] [CODE]<script type="text/javascript"> function changeAction1(form) { form.action = "get.php" } function changeAction2(form) { form.action = "insert9x.php" … |
| | Hello, I'm new to the forum and have a question about a database design and the resulting relationships. I'm creating a database which (amongst other things) will hold fixtures for a sports league. I have the following two important tables: [B]FIXTURES[/B] fixture_id (KEY) home_team_id (FOREIGN) away_team_id (FOREIGN) [I]etc...[/I] [B]Teams[/B] team_id … |
| | I am trying to access a Mysql Server through Lan using VB6 using ADODB connection db.Open "DRIVER={MySQL ODBC 5.1 Driver};DATABASE=xxxx;SERVER=192.168.1.6;USER=root;PASSWORD=xxxx;OPTION=3;" it is giving error [Mysql][ODBC 5.1 Driver]host couldn't connect to the Mysql Server My Server IP is :192.168.1.6 user is: root Firewalls are turned off.... Might be i need to …  |
| | Hey, I have a project that requires me to use two different servers. It's a website, half is written in PHP and the other in ASP.NET both on separate servers. The problem is the ASP.NET address in an IP like [url]http://69.101.26.113/website[/url]. Is there anyway to change this in C# or … |
| | |
| | Hi, I'm having a hard time getting my applet to even build right. Here are the instructions my instructor gave: [I]"Develop a Java applet that will help an elementary school student learn multiplication. Use the Math.random method or a Random object to produce two positive one-digit integers. The program should … |
| | [code] Statement statement = connection.createStatement(); String frmdate = request.getParameter("date1"); String todate = request.getParameter("date2"); SimpleDateFormat df = new SimpleDateFormat("DD/MM/YYYY"); //Date frmdate = df.parse("strdate1"); //Date todate = df.parse("strdate2"); try { // java.util.Date date3 = df.parse(frmdate); // java.util.Date date4 = df.parse(todate); java.util.Date ufdate1 = df.parse(frmdate); java.util.Date utdate2 = df.parse(todate); java.sql.Date fs1 = new …  |
| | Hi I recently learnt how to do crash collision based on colours. So you can use something like img.getpixel(0,0) to retrieve the colour of the pixel at (0,0) on the picture "img." I have experimented quite a lot with it and have managed to make some programs that draw a … |
| | I have spent over a WEEK trying to figure out why my code isn't working. It's a long code, I will post it all but I will break down the code as I explain. First off, I have called double[] arrays and then initialized them later on in the program … |
| | Anyone to help with protected mode programming,like help me create a a data descriptor pointing to 0b800h when i try to write to RAM it rebbots |
| | hi all, i am having a problem. i had a projects page and list of projects can be seen with radio buttons. so wen we select a project and click submit we go to the upload page and the value of radio button is send to upload page by url. … |
| | my teacher wants the tictactoe game to have a button called play that resets the tictactoe game my button doesn't work....what did i do wrong? [CODE] //TicTacToePanel.java Author Carien Anderson //Represents tic tac toe game board and allows peer to peer competition import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.JOptionPane; … |
The End.