Software Development Forum

Ok, i have my code: [CODE] int seconds; clock_t clock(); seconds = clock()/CLOCKS_PER_SEC; if (seconds == 8){ FIVE.SetPositionX(-1); } //.... if ((AdventureGame.keypressed[DIK_F]) && (WOO.positionX == -10)){ //reset clock() here FIVE.SetPositionX(-5);} [/CODE] the clock starts when the program is run and after 8 secs, FIVE moves position. When i press F, …

I have set the textbox to public so that another form can access it but when i run it in debug mode with the following line it gives me exception so it doesn't store correct directory. For example: If I enter D:\newfolder it gives me D:\\newfolder. Why does it add …

I have a panel in which I have many controls. I want to print this panel in window application. How can i do this. please send me code for it.

Hi, I was comparing the features visual Basic & visual studio at that time i found that in VB provide the facility of message box. But in VS we don’t have the facility of input box. The input box is really very helpful if we want to take some input …

I'm already build this program but get error...anyone can check for me?..tq [CODE] public class Clock { private int hour; private int minute; private int second; public Clock (int hour, int minute, int second) { this.hour = hour; this.minute = minute; this.second = second; } public Clock (Int hour, int …

Would Java be able to .rename() a file while it is still being written, or will it detect that the file is in use? Also, is it possible to open a file for exclusive access in Java, and will this fail if the file is still being written? Thanks.

Hi, this is not a homework or assignment. I am preparing for interviews. I just wanted to know how do I find out say the next 6 byte aligned address given any random address? Hope I am clear. Any code or explanation will be appreciated. Thanks.

i am using visual studio for making website using c# an error is occuring "There is already an open DataReader associated with this Command which must be closed" the code is public partial class _Default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { Getregioncategory(); } public void Getregioncategory() …

i want to know the advantages and disadvantages of single and multiple line comment in programming language in term of reliability, readability and writability. please help

Just a curious Question, Is there a way of putting Vpython in wxpython as we do in case of wx.MediaCtrl and other stuffs?

5. Write a program to automatically generate the telephone numbers. The requirements are as follows: Declare a character array to hold a 7-digit telephone number •Accept the telephone number as a string. The first four digits is the department code and the last three digits is the telephone number. (Example: …

hello can you help me how i can catch the exception... I want to input integer for my array and i want to catch the exception if i will input a string this will display Invalid input how can i use this in try catch because i am confuse please …

How to declare an array to store the different five(5) name and initialize the following char array with {"Lara","Lin","Nitin","Krishna","Sophia"}

Can someone tell me how to display an image with pygame. By the way I am using python 3.x.

Hello i have a code here that partially works...the point in the program is to store 10 array integers then outputs how many times that integer is entered ex. input: 1 1 1 1 1 2 3 3 2 99 output : 1 = 5 2 = 2 3 = …

So basically, I have this GUI program. I can run it, and it displays a graph of some data. The thing is, I want to put this program inside of JFramebuilder, and make changes to it. I dont know if it is even possible, but I figured if I opened …

Below is a Base Conversion Class that will take in any number (up to around 2.4 billion digits (limited by string.substring's integer property)), It will convert from any base to any base (from 2-36 inclusive) It does have some simple error handling such as if you enter a number that …

I am working my way through an online book--Intro to Java Programming by David Eck--and in it he says that it is generally considered bad style to use the getGraphics() method to draw outside of a component's paintComponent method. Does anyone know why this is?

Hello all I am new to the community and have been stumbing across a problem with my code. I have a program that is connecting to an oracle database. I am using the table adapter to fill a combobox to select a model. Then I am connecting to the database …

Hello again, How can I count the message size from: [CODE] msg.Body = tbText.Text; [/CODE] ? I need to get KBs.

Hi, I had to wipe a computer and reinstall the operating system and eclipse. i had backed up two of my projects in my working folder for eclipse. i copied those project folder into my new working eclipse folder, but i can't seem to open them. Open project is grayed …

So, I've been getting some help from the community on some issues (mainly G_Waddle, thanks again!). I'm a VB6 rookie, and it's been a while since I even did coding with that. So, basically here is my VB6 snippet. It's very straight forward and easy to code in VB6, but …

I'm trying to convert a simple program fron vb6. IT's only draggin several pictures with the mouse and drop them into anothet picture (trashbin). If the object picture dropped is a match then the trashbin.image changes to another image But: First, I don't know how to allow drag controls!!!

Not sure if this is the correct forum. I am using Inno and within the scripting portion I cannot figure out how to convert a cardinal value into a string so it can be displayed in a MsgBox() so I can verify the value. When I convert the cardinal using …

Why won't this if statement compile? [CODE]int main1() { char o[15]; cin >> o; if(o == 'oscar') main2(); else cout << "\n\aIncorrect password.\n" << endl; main(); cin.clear(); cin.ignore(255, '\n'); cin.get(); return 0; }[/CODE] I am trying to set a password to access the program

Hi, I'm using istream_iterator to read input from standard i/p and writing it to standard o/p using ostream_iterator. I expected it to print the input to the console when I hit enter and then exit but it loops for next input after printing and so on. [code=c++] #include <iostream> #include …

I ve managed to get this far on my first C# app. The problem is when I am adding files and creating a sub directory to a already existing folder it works but when I re-do the action it won't create a new sub directory as the previous one, as …

Please help me with this bug. I have python 3.0 and I was using pygame and for some reason it isn't reconizing [CODE]windowSurface[/CODE] here Is the code Im having problems with and thanks in advance. [CODE]import pygame, sys, random from pygame.locals import * #*******************************************SETUPVAR************************************************** BLACK = (0, 0, 0) WHITE …

please help me to get the month only from system. which mean the program dont need to display time , day and also year. how to do with it? i only know to display date. urgent, assignment needed. thanks alot first.

[CODE] package com.ibm.compbio; public abstract class DynamicProgramming { private Cell prevCell; private int score; private int row; private int col; protected String sequence1; protected String sequence2; protected Cell[][] scoreTable; protected boolean tableIsFilledIn; protected boolean isInitialized; public Cell(int row, int col) { this.row = row; this.col = col; } /** * …

I have this sequence in the text file >sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG HGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE TMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQD QYGEPPSQRVMLGDERHGARESFLD I want to split this into list as [[COLOR="Red"]'[/COLOR]>sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1][COLOR="Red"]'[/COLOR],[COLOR="Red"]'[/COLOR]MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG …

Hello Everybody I am facing some problems while processing a file containing a several lines like this : 1 1134177124.U.0 1134177124.+.613 1134177163.+.2234 1134208365.D 1134520916.U.0 I need to arrange it like this: 1 1134177124 U 0 1 1134177124 + 613 1 1134177163 + 2234 1 1134208365 D 1 1134520916 U 0 …

Hello all, I've had some java experience and looking at my uni units next semester, 1 involves using C, so I decided to start coding C :p. Is there anything wrong with the program structure below? I think there is also some code duplication in there also. [CODE]#include <stdio.h> /* …

[CODE]package ATM; // ATM.java import javax.swing.*; public class ATM { private boolean userAuthenticated; // user authentication private int currentAccountNumber; // current account number private Screen screen; // JOptionPane (pop-up(s)) private CashDispenser cashDispenser; // virtual cash dispenser private DepositSlot depositSlot; // virtual deposit slot private BankDatabase bankDatabase; // account database private …

Is there a way to programmatically set the insert point in a multiline richTextbox? Example: I have a (almost) free format message where the reciever is expected to enter his own information at certain points (marked with a special char-sequence), before the message is processed further. A richTextbox.Find will find …

I have recently converted my old project based on C#.NET to my new V.Studio 2010, the project was first created using .NET framework 2.0. In my designer mode within VS2010, all combo boxes, buttons etc. look new (like windows xp button/vista/7 application buttons). however, whenever i debug or even release …

Hi Guys i am trying to insert xml file in database but i am getting this error text/xmldecl not at the beginning of input.Can anyone tell me how to fix this. thanks

Hello, I am trying to create a new sub directory in an all ready created Folder. What happens is that when files are transferred from one directory to another it creates a sub directory everytime and places the files into it. I have got the part working for the creation …

Hi Guys i'm writing a macro in excel that need a down arrow send at one point. Below is the script Sheets("1").Select Range("A4").Select Selection.End(xlDown).Select Sheets("2").Select Range("A4").Select Range(Selection, Selection.End(xlDown)).Select Range(Selection, Selection.End(xlToRight)).Select Selection.Copy Sheets("1").Select ActiveSheet.Paste Selection.End(xlDown).Select SendKeys ("DOWN") ' I need to send the down arrow here' How do i do it …

G'day all... I know there's a sticky in this forum for books that are recommended as C++ references from newbies to advanced coders. What I'm wondering is this... What are the online resources you [B]most[/B] recommend for C++ coders? What I'm looking for are those resources that are so useful …

class C{ public static void main(String a[]) { int i1=9; int i2; if(i1>3) { i2=8; } System.out.println(i2); }}

Hi i'm developing an app where i'm reading a value from a device and putting it into a mysql db, i have setup a function where the vb will calculate whether the new value being read has changed by 3% from the last value and if it has run the …

Hello friends, I have a small problem with printing/getting exceptions in 3.1 version. My code is: [CODE=Python] try: # bla bla... except Exception, e: # here I got error message "Invalid Syntax" in the comma self.setError(e) return False [/CODE] What is the correct syntax in python 3.1 to get the …

i want to make a save button for images without having to open a save file dialog so i would specify the name and location to save in the code please help

Iam Having three dropdown lists named Department,StaffID,StaffType,textbox Name and one submit button...If I select Department as BEMechanical and click the button i have to get all the details regarding that branch and if i select Department,StaffID,stafftype and name i should get the details of the selected one.Any one plz help …

hi, i have create a program in C# windows application with backend SQl Server 2005. I have a done coding for save, delete,update. save and delete is working properly. But update in that i have an error message taht datetime is not in proper format.what should i do to convert …

Command line arguments in linux usin C programming lanuage

We have an app that uses a sqlexpress db. We need our customers to be able to swap the database for this app out for another sqlexpress db fairly easily. So we came up with a small launcher app that allows them to choose the db they want from a …

i was trying to make a [URL="http://devvicky.com/"]free microsoft word[/URL] plugin in vb.net. It automatically fills a web form. The main problem with the plugin is that it uses web browser control and once it has filled a form it will need to navigate another form. The form can only be …

Help me! I just can't seem to get this right. I'm trying to open an Excel file(Template) and put data from msflexgrid into a specific place in the excel file but i just can't seem to get it right. Can anyone help me with this coding? Much appreciated. Thank you …