64,152 Solved Topics
Remove Filter  | |
| | I am able to attach a file using SwiftMailer with its name hardcoded. But what if the file is uploaded by a user from an HTML form's 'file' input type control and has to be sent with an email by a PHP script? How do I specify the file name … |
 | Hi, I'm using istream_iterator to read input from standard i/p and writing it to standard o/p using ostream_iterator. I expected it to print the input to the console when I hit enter and then exit but it loops for next input after printing and so on. [code=c++] #include <iostream> #include … |
| | I ve managed to get this far on my first C# app. The problem is when I am adding files and creating a sub directory to a already existing folder it works but when I re-do the action it won't create a new sub directory as the previous one, as …  |
 | Hi All, I am new to this particular forum because I will like to start working with ASP.NET (it's required in my job) but I haven't the faintest idea anything pertaining ASP.NET. I hear things like Configuring IIS and Visual Studio...I was told that this is for a web-based application...could … |
| | hi, i need validate dinamic table javascript before i insert data do db, i m new here. please help me. here is code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Untitled Document</title> </head> </script> <script type="text/javascript"> /*<![CDATA[*/ function addRow() { var … |
| | Does openable get ignored? if not what does it do? [CODE] function openSomething(openable $obj) { $obj->open(); }[/CODE] openable is a class btw. taken from a book. |
 | Please help me with this bug. I have python 3.0 and I was using pygame and for some reason it isn't reconizing [CODE]windowSurface[/CODE] here Is the code Im having problems with and thanks in advance. [CODE]import pygame, sys, random from pygame.locals import * #*******************************************SETUPVAR************************************************** BLACK = (0, 0, 0) WHITE … |
 | please help me to get the month only from system. which mean the program dont need to display time , day and also year. how to do with it? i only know to display date. urgent, assignment needed. thanks alot first. |
| | [CODE] package com.ibm.compbio; public abstract class DynamicProgramming { private Cell prevCell; private int score; private int row; private int col; protected String sequence1; protected String sequence2; protected Cell[][] scoreTable; protected boolean tableIsFilledIn; protected boolean isInitialized; public Cell(int row, int col) { this.row = row; this.col = col; } /** * … |
| | I have this sequence in the text file >sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG HGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE TMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQD QYGEPPSQRVMLGDERHGARESFLD I want to split this into list as [[COLOR="Red"]'[/COLOR]>sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1][COLOR="Red"]'[/COLOR],[COLOR="Red"]'[/COLOR]MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG … |
| | Hello Everybody I am facing some problems while processing a file containing a several lines like this : 1 1134177124.U.0 1134177124.+.613 1134177163.+.2234 1134208365.D 1134520916.U.0 I need to arrange it like this: 1 1134177124 U 0 1 1134177124 + 613 1 1134177163 + 2234 1 1134208365 D 1 1134520916 U 0 … |
| | Hello all, I've had some java experience and looking at my uni units next semester, 1 involves using C, so I decided to start coding C :p. Is there anything wrong with the program structure below? I think there is also some code duplication in there also. [CODE]#include <stdio.h> /* … |
| | [CODE]package ATM; // ATM.java import javax.swing.*; public class ATM { private boolean userAuthenticated; // user authentication private int currentAccountNumber; // current account number private Screen screen; // JOptionPane (pop-up(s)) private CashDispenser cashDispenser; // virtual cash dispenser private DepositSlot depositSlot; // virtual deposit slot private BankDatabase bankDatabase; // account database private … |
| | Is there a way to programmatically set the insert point in a multiline richTextbox? Example: I have a (almost) free format message where the reciever is expected to enter his own information at certain points (marked with a special char-sequence), before the message is processed further. A richTextbox.Find will find …  |
| | I have recently converted my old project based on C#.NET to my new V.Studio 2010, the project was first created using .NET framework 2.0. In my designer mode within VS2010, all combo boxes, buttons etc. look new (like windows xp button/vista/7 application buttons). however, whenever i debug or even release … |
| | Hi Guys i am trying to insert xml file in database but i am getting this error text/xmldecl not at the beginning of input.Can anyone tell me how to fix this. thanks |
| | Hello, I am trying to create a new sub directory in an all ready created Folder. What happens is that when files are transferred from one directory to another it creates a sub directory everytime and places the files into it. I have got the part working for the creation … |
| | Hi, I am new to php and have to do a project that consists of a joke page, a jokelist page and the front page or index page. My problem is this: I have used the text below in my .htaccess page and the only thing I get when I … |
| | Hi Guys i'm writing a macro in excel that need a down arrow send at one point. Below is the script Sheets("1").Select Range("A4").Select Selection.End(xlDown).Select Sheets("2").Select Range("A4").Select Range(Selection, Selection.End(xlDown)).Select Range(Selection, Selection.End(xlToRight)).Select Selection.Copy Sheets("1").Select ActiveSheet.Paste Selection.End(xlDown).Select SendKeys ("DOWN") ' I need to send the down arrow here' How do i do it …  |
 | G'day all... I know there's a sticky in this forum for books that are recommended as C++ references from newbies to advanced coders. What I'm wondering is this... What are the online resources you [B]most[/B] recommend for C++ coders? What I'm looking for are those resources that are so useful …  |
| | class C{ public static void main(String a[]) { int i1=9; int i2; if(i1>3) { i2=8; } System.out.println(i2); }} |
| | Hi i'm developing an app where i'm reading a value from a device and putting it into a mysql db, i have setup a function where the vb will calculate whether the new value being read has changed by 3% from the last value and if it has run the … |
 | Hello friends, I have a small problem with printing/getting exceptions in 3.1 version. My code is: [CODE=Python] try: # bla bla... except Exception, e: # here I got error message "Invalid Syntax" in the comma self.setError(e) return False [/CODE] What is the correct syntax in python 3.1 to get the … |
| | Please help; I have input text data from a form into mySQL table, recovered it using php script and written it back to the form using value=var[ ]. If the data has spaces in it, i.e. more than one word, all characters after the first space are lost. But echo … |
 | i want to make a save button for images without having to open a save file dialog so i would specify the name and location to save in the code please help |
| | Iam Having three dropdown lists named Department,StaffID,StaffType,textbox Name and one submit button...If I select Department as BEMechanical and click the button i have to get all the details regarding that branch and if i select Department,StaffID,stafftype and name i should get the details of the selected one.Any one plz help … |
| | Invalid postback or callback argument. Event validation is enabled using <pages enableEventValidation="true"/> in configuration or <%@ Page EnableEventValidation="true" %> in a page. For security purposes, this feature verifies that arguments to postback or callback events originate from the server control that originally rendered them. If the data is valid and … |
| | hi, i have create a program in C# windows application with backend SQl Server 2005. I have a done coding for save, delete,update. save and delete is working properly. But update in that i have an error message taht datetime is not in proper format.what should i do to convert … |
| | Command line arguments in linux usin C programming lanuage  |
 | I have tried whatever I can but i'm yet to find a definition I can understand. Would anyone try to "educate" me on what is enterprise java beans? |
 | hi! please help am still new on ASP and am having trouble deleting from a table please help. the code i used is this: [code=asp] <% set conn=Server.CreateObject("ADODB.Connection") conn.Open "Provider=SQLNCLI;Server=THABO-2A88C6501\SQLEXPRESS;Database=customers;User ID=sa;Password=thabo;" set rs=Server.CreateObject("ADODB.recordset") if request("Delete")="Delete" then sql="DELETE * FROM Details WHERE Cust_ID='4567'" end if%> <center><form method="post" action="Delete.asp"> <input type="submit" name="Delete" … |
| | We have an app that uses a sqlexpress db. We need our customers to be able to swap the database for this app out for another sqlexpress db fairly easily. So we came up with a small launcher app that allows them to choose the db they want from a … |
| | i was trying to make a [URL="http://devvicky.com/"]free microsoft word[/URL] plugin in vb.net. It automatically fills a web form. The main problem with the plugin is that it uses web browser control and once it has filled a form it will need to navigate another form. The form can only be … |
| | Help me! I just can't seem to get this right. I'm trying to open an Excel file(Template) and put data from msflexgrid into a specific place in the excel file but i just can't seem to get it right. Can anyone help me with this coding? Much appreciated. Thank you …  |
| | Hi, I would just like to know if an asp.net application automaticaly set multi users active. Meaning if more than one user can activate the application on the web and use the same database without interfering with one another. Regards Weppies |
| | Hi Friends I want to create a product renewal alert with PHP I have three field in SQL Table 1. Id 2. product_name 3. order_date 4. expired_date 5. username Please Help. i want to show the renewal alert before 15 days of expired date |
| | i need some project topics in image processing and image compression to do my final projects send me some list plaese.... |
| | I want to set resolution automatically when my program will run. I want to make it (resolution) 1280*1024. What should I write there in my vb.net program to set resolution when my program will run? When user will stop using my program it will get default resolution. Thats all. Please … |
| | How would you modify this gui code to designate only certain spots on your canvas to drop your image? Like when your playing solitaire and the game only allows you to drop your card in a certain spot. [URL="http://www.daniweb.com/forums/post1111987.html#post1111987"]http://www.daniweb.com/forums/post1111987.html#post1111987[/URL] |
| | Hi, I have a small problem and have been trying to figure out a solution for this without any success days. I did search the forum but didn't find any solution. This is my situation. I am generating a chart (using an opens source chart called amCharts) that allows me … |
| | Anyone know how to implement a timer code? What do i have to do in order to implement a timer? And the timer is one minute and then the vb program continues. thank you so much. |
| | [code] $sql_table_get=mysql_query("select orderline.quantity, menu.item_name, menu.price from orderline, menu, orders where orderline.item_id = menu.item_id and orders.order_id = orderline.order_id and orders.table_num =table".'"$count"'." // problem line and orders.order_status = 0; "); [/code] tried many combo and couldn't make it work yet. basically i just need to know how to combine a $variable and … |
| | Is there a way to provide a different address when browser bookmark button is clicked? I know you can include a button on your page but most users are accustomed to using the browser bookmark button. Our domain may change from time to time and we don't want to frustrate … |
 | How to allow user to create photo album and upload photo or images?  |
 | Is there a way to accomplish the following in python? [CODE=javascript] try{ // something } catch (e) { // display e.message, e.name, e.linenumber } [/CODE]  |
 | Hey Guys, I'm having some trouble compiling my code. it says that there's an error in one of apple's header files. /Developer/Platforms/iPhoneOS.platform/Developer/SDKs/iPhoneOS3.1.3.sdk/usr/include/arm/_types.h:13: error: expected constructor, destructor, or type conversion before ‘typedef’ nvm, solved |
 | I am trying to get the following code to take in either a number or an integer, determine whether what the user inputted is an integer or a letter, and then print a random digit if it is an integer, or a random letter if it is a letter. [CODE]#include …  |
| | Hi, First off, I'm a real greenhorn so please forgive me asking questions which may be bleeding obvious, but I have searched and searched and cannot find an answer to my problem. I'm trying to import a CSV file into sqlite3 database in python. The CSV file has 56 columns …  |
| | Hello, I googled about this problem and there are some suggestion to handle this. i have tried but none solve my problem. Errors are shown in line 3, 4 an 5 which code is like below: [CODE] ob_start(); //stop caching header("Pragma: no-cache"); header("Cache: no-cache"); session_start(); [/CODE] can anyone help me … |
| | What approach should I use to return all dict keys that have the maximum value. The code below outputs 1, but I would like for it to return 1, 2. [CODE]import operator d1 = dict() d1[0] = 1 d1[1] = 2 d1[2] = 2 maxValue = max(d1.iteritems(), key=operator.itemgetter(1))[0] [/CODE] |
The End.