Software Development Forum

Tool.h file [CODE] #ifndef TOOL_H #define TOOL_H #include <string> using std::string; const int LENGTH = 30; class Tool { Tool ( int = -1; string = " "; int = 0; double = 0.0 ); public: int getPartNumber(); int setPartNumber( void ); char getToolName(); int setToolName( void ); int getInStock(); …

How to declare an array to store the different five(5) name and initialize the following char array with {"Lara","Lin","Nitin","Krishna","Sophia"}

Can someone tell me how to display an image with pygame. By the way I am using python 3.x.

Hello i have a code here that partially works...the point in the program is to store 10 array integers then outputs how many times that integer is entered ex. input: 1 1 1 1 1 2 3 3 2 99 output : 1 = 5 2 = 2 3 = …

So basically, I have this GUI program. I can run it, and it displays a graph of some data. The thing is, I want to put this program inside of JFramebuilder, and make changes to it. I dont know if it is even possible, but I figured if I opened …

Below is a Base Conversion Class that will take in any number (up to around 2.4 billion digits (limited by string.substring's integer property)), It will convert from any base to any base (from 2-36 inclusive) It does have some simple error handling such as if you enter a number that …

Hello all I am new to the community and have been stumbing across a problem with my code. I have a program that is connecting to an oracle database. I am using the table adapter to fill a combobox to select a model. Then I am connecting to the database …

Basically everyone should laugh at how stupid this may sound but this code is somehow wrong... which is funny because it is as simple as hello world.... [CODE]#include "stdafx.h" #include <iostream> using namespace std; int main(void) { cout << "Wake up, Neo.\n"; Sleep(6000); cout << "The Matrix has you.\n"; Sleep(6000); …

Hey guys, I've got this code implemented below in my UI form... and calling it from another thread. On debugging the 'else' part throws an TargetParameterCountException... I'm clueless has to why... [code] public delegate void SolveDrawMaze(Cell aCell); public void SolveDraw(Cell aCell) { if (InvokeRequired) { this.BeginInvoke(new SolveDrawMaze(DoMe)); } else { …

Hello again, How can I count the message size from: [CODE] msg.Body = tbText.Text; [/CODE] ? I need to get KBs.

hiiii, can anyone tell me about computational complexity of AES, DES and BLOWFISH techniques. i am using these techniques for a string. and calculating execution time of these thre techniques. and now want to know their complexity on the basis of execution time... plzzz Help me out! Regards!

I want to write a Code in C which can create copy any given file (txt, bmp, jpg, pdf etc) what i've written so far is: int main(){ FILE *fp; char ch; FILE *fpW; if((fpW = fopen("file2.gif","wb"))==NULL) { printf("Cannot open Destination file.\n"); exit(1); } if((fp = fopen("file.gif","rb"))==NULL) { printf("Cannot open …

Hey, im new to the forum and im trying to learn c++, so i bought a book. On a programming exercise i was asked to create a program that would take a persons full name, letter grade, then subtract the letter grade (ie: A to B), and age and display …

hi, I put together a small app to try using SEE in assembly, but I am getting the wrong output. these are the .cpp file and the .asm file [code=cpp] #define WIN32_LEAN_AND_MEAN #include <iostream> using namespace std; extern "C" int *myFunc(float *a, float *b, float *result); int main(int argc, char …

Going through a text to help cement my knowledge of C++ but found code that wasn't explained and looks kinda odd to me. [CODE] #include <iostream> #include <string> int main() { using namespace std; char ch; int count = 0; cin.get(ch); while(ch != '\n') { cout << ch; ++count; cin.get(ch); …

Hi, I had to wipe a computer and reinstall the operating system and eclipse. i had backed up two of my projects in my working folder for eclipse. i copied those project folder into my new working eclipse folder, but i can't seem to open them. Open project is grayed …

[CODE] //copy database files to target directory string fileName = "test.txt"; string targetPath = StaticFormInstances.choose.txtbxTargetDir.Text; string sourcePath = @"\\il93fil48\3GSM\release\testapplication_REL_01_00_09\database"; //Use Path Class to manipulate file and directory paths string sourceFile = System.IO.Path.Combine(sourcePath, fileName); string destFile = System.IO.Path.Combine(targetPath, fileName); //Create a new target folder if it doesn't exist if (!System.IO.Directory.Exists(targetPath)) { …

So, I've been getting some help from the community on some issues (mainly G_Waddle, thanks again!). I'm a VB6 rookie, and it's been a while since I even did coding with that. So, basically here is my VB6 snippet. It's very straight forward and easy to code in VB6, but …

Hi everyone, I'm a moderately experienced C++ programmer who's trying to do a little socket work. Don't ask why, but I'm to write a program which, when activated, sends an HTTP POST request to a remote end server. The socket part of the work is done and successfully tested; all …

Hi i hve to turn in this homework today and i have not been able to come up with the logic here is what it is need it and what i have wrote so far if you are interested i am willing to pay for it, thanks Program Description: A …

My window application gives error-"Operation must use an updateable query" while run in vista.I used update and insert statements.How can I provide permission to write/update in Ms Access database.

I'm trying to convert a simple program fron vb6. IT's only draggin several pictures with the mouse and drop them into anothet picture (trashbin). If the object picture dropped is a match then the trashbin.image changes to another image But: First, I don't know how to allow drag controls!!!

Okay so this is part of an assignment I have to do, but I am confused regarding the library routine as my professor has not covered it well. So my thing is what do it do to create the library...is it just a .h file with all the functions specified …

Not sure if this is the correct forum. I am using Inno and within the scripting portion I cannot figure out how to convert a cardinal value into a string so it can be displayed in a MsgBox() so I can verify the value. When I convert the cardinal using …

Hello. I am looping through files in a folder and need to remove empty columns of a spreadsheet in a given range of A-G (at least any column between these ranges may be blank). I eventually want to do the same thing with the rows. I have revised my code, …

Hi, I wonder how can access to a static method of a class called width from another object that has an attribute called width too: ex: [CODE] public class width{ private int test; public static int testValue(){ return this.test; } } public class Rect{ private int width; private int height; …

Why won't this if statement compile? [CODE]int main1() { char o[15]; cin >> o; if(o == 'oscar') main2(); else cout << "\n\aIncorrect password.\n" << endl; main(); cin.clear(); cin.ignore(255, '\n'); cin.get(); return 0; }[/CODE] I am trying to set a password to access the program

How can I get a password that has been changed during the use of the program to be applied so that after the program is ended and started again, when it prompts for a password to start the program it wants the new password the user entered, not the original …

Hello, Say I have an abstract class Connection to represent some kind of connection that can be executed and then return some kind of result. My problem is that the result returned by each connection varies (String, byte[], some other class, etc...). This results in additional logic that seems like …

Hi there, I'm having some trouble formatting the date that appears underneath each "News" post on the following page - [URL="http://www.rjt-online.com/home.php"]www.rjt-online.com/home.php[/URL] Here is the code for the XSL file that is being pulled into the above page with php. The xsl file is pulling in an RSS feed from my …

Hi, I'm using istream_iterator to read input from standard i/p and writing it to standard o/p using ostream_iterator. I expected it to print the input to the console when I hit enter and then exit but it loops for next input after printing and so on. [code=c++] #include <iostream> #include …

how to make disable for 'task manager' when i press Ctrl+Alt+Del (in c#)? pls could you help me my all fri. very appreciate your help :)

I ve managed to get this far on my first C# app. The problem is when I am adding files and creating a sub directory to a already existing folder it works but when I re-do the action it won't create a new sub directory as the previous one, as …

I need to create a C++ program, that one could get a list of suggestions when he's typing. for example: when we type the letter 'A', a list of words that start with the letter A should display. then when we type another letter 'P', the words should filter and …

Hi, I'm just starting my way in C# and I have this question/problem: I've created a "Windows form" project with several forms, where Form1 is the main form and it is also has a statusStrip control. I've managed to change the text in it with a method in Form1, but …

How to change this applet to swing? [CODE]import java.applet.Applet; import java.awt.*; import java.io.PrintStream; public class Hounds extends Applet { public String getAppletInfo() { return "Hare and Hounds"; } public String[][] getParameterInfo() { return parameterInfo; } public void init() { String s = getParameter("bgColor"); try { BG_COLOR = s != null …

Ok well my assignment is to write a program to gives me the total resistance in a circuit. The user is prompted for the resistance type and resistor value such as <1 200> 1 meaning in series, and 200 being the value of the resistor. When the user imputs -1 …

How can I create a a invisible form background? I dont want to use opacity.

Hi, I have a strange kind of problem. I never faced it nither heard about it. All controls are disappeared from Design mode.:'( [COLOR="Red"]Form.Designer.cs [/COLOR]is having complete code of control initialization but there is no control in design mode... :confused: I tried to add new controls with same name, it …

How do i split a string word by word and store each word into a hashtable? please help Thanks, Saula

Please help me with this bug. I have python 3.0 and I was using pygame and for some reason it isn't reconizing [CODE]windowSurface[/CODE] here Is the code Im having problems with and thanks in advance. [CODE]import pygame, sys, random from pygame.locals import * #*******************************************SETUPVAR************************************************** BLACK = (0, 0, 0) WHITE …

hey whatzzzup guys??? i just want to know if this c++ programming language is hard co'z my clasmates are keep on complaining abort that hehe

Hello, I am trying to write a simple program which listens to some data on network and writes to a file. I decided to use mmapped files because the data is very large (magnitude of 3-5 Gigs) and very fast. so as expected, i put the data in queue and …

please help me to get the month only from system. which mean the program dont need to display time , day and also year. how to do with it? i only know to display date. urgent, assignment needed. thanks alot first.

[CODE] package com.ibm.compbio; public abstract class DynamicProgramming { private Cell prevCell; private int score; private int row; private int col; protected String sequence1; protected String sequence2; protected Cell[][] scoreTable; protected boolean tableIsFilledIn; protected boolean isInitialized; public Cell(int row, int col) { this.row = row; this.col = col; } /** * …

I have this sequence in the text file >sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG HGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE TMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQD QYGEPPSQRVMLGDERHGARESFLD I want to split this into list as [[COLOR="Red"]'[/COLOR]>sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1][COLOR="Red"]'[/COLOR],[COLOR="Red"]'[/COLOR]MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG …

Hello Everybody I am facing some problems while processing a file containing a several lines like this : 1 1134177124.U.0 1134177124.+.613 1134177163.+.2234 1134208365.D 1134520916.U.0 I need to arrange it like this: 1 1134177124 U 0 1 1134177124 + 613 1 1134177163 + 2234 1 1134208365 D 1 1134520916 U 0 …

Hello all, I've had some java experience and looking at my uni units next semester, 1 involves using C, so I decided to start coding C :p. Is there anything wrong with the program structure below? I think there is also some code duplication in there also. [CODE]#include <stdio.h> /* …

[CODE]package ATM; // ATM.java import javax.swing.*; public class ATM { private boolean userAuthenticated; // user authentication private int currentAccountNumber; // current account number private Screen screen; // JOptionPane (pop-up(s)) private CashDispenser cashDispenser; // virtual cash dispenser private DepositSlot depositSlot; // virtual deposit slot private BankDatabase bankDatabase; // account database private …

Is there a way to programmatically set the insert point in a multiline richTextbox? Example: I have a (almost) free format message where the reciever is expected to enter his own information at certain points (marked with a special char-sequence), before the message is processed further. A richTextbox.Find will find …