199,114 Archived Topics
Remove Filter  | |
| | So, I've been getting some help from the community on some issues (mainly G_Waddle, thanks again!). I'm a VB6 rookie, and it's been a while since I even did coding with that. So, basically here is my VB6 snippet. It's very straight forward and easy to code in VB6, but … |
| | Hi everyone, I'm a moderately experienced C++ programmer who's trying to do a little socket work. Don't ask why, but I'm to write a program which, when activated, sends an HTTP POST request to a remote end server. The socket part of the work is done and successfully tested; all … |
| | Hi i hve to turn in this homework today and i have not been able to come up with the logic here is what it is need it and what i have wrote so far if you are interested i am willing to pay for it, thanks Program Description: A …  |
| | My window application gives error-"Operation must use an updateable query" while run in vista.I used update and insert statements.How can I provide permission to write/update in Ms Access database. |
| | I'm trying to convert a simple program fron vb6. IT's only draggin several pictures with the mouse and drop them into anothet picture (trashbin). If the object picture dropped is a match then the trashbin.image changes to another image But: First, I don't know how to allow drag controls!!!  |
| | Okay so this is part of an assignment I have to do, but I am confused regarding the library routine as my professor has not covered it well. So my thing is what do it do to create the library...is it just a .h file with all the functions specified …  |
| | hi, I need to update my data in two tables simultaneously,for example if i update product id in one aspx page it should be updated in my sql tables where i use product id in all my pages we can join tables to view data but how to update.. hope … |
| | Not sure if this is the correct forum. I am using Inno and within the scripting portion I cannot figure out how to convert a cardinal value into a string so it can be displayed in a MsgBox() so I can verify the value. When I convert the cardinal using … |
| | Hello. I am looping through files in a folder and need to remove empty columns of a spreadsheet in a given range of A-G (at least any column between these ranges may be blank). I eventually want to do the same thing with the rows. I have revised my code, … |
| | Hi, I wonder how can access to a static method of a class called width from another object that has an attribute called width too: ex: [CODE] public class width{ private int test; public static int testValue(){ return this.test; } } public class Rect{ private int width; private int height; … |
| | I run a small database for a very small business. I am normalizing our database which keeps track of our orders for repairs. I have one of the tables in 2NF but I am not sure how to normalize it further. Here is an example of how it looks: [code] … |
| | HI All, :D I'm computer science student. Would you like to tell me about that problem? Here. 1) RE for accepts all strings of (a,b,c) that contains an odd number of a's. 2)Re for the language of all binary of strings that have at least three symbols and whose first … |
 | Why won't this if statement compile? [CODE]int main1() { char o[15]; cin >> o; if(o == 'oscar') main2(); else cout << "\n\aIncorrect password.\n" << endl; main(); cin.clear(); cin.ignore(255, '\n'); cin.get(); return 0; }[/CODE] I am trying to set a password to access the program |
| | How can I get a password that has been changed during the use of the program to be applied so that after the program is ended and started again, when it prompts for a password to start the program it wants the new password the user entered, not the original … |
| | Hello, Say I have an abstract class Connection to represent some kind of connection that can be executed and then return some kind of result. My problem is that the result returned by each connection varies (String, byte[], some other class, etc...). This results in additional logic that seems like …  |
| | I am able to attach a file using SwiftMailer with its name hardcoded. But what if the file is uploaded by a user from an HTML form's 'file' input type control and has to be sent with an email by a PHP script? How do I specify the file name … |
| | Hi there, I'm having some trouble formatting the date that appears underneath each "News" post on the following page - [URL="http://www.rjt-online.com/home.php"]www.rjt-online.com/home.php[/URL] Here is the code for the XSL file that is being pulled into the above page with php. The xsl file is pulling in an RSS feed from my …  |
 | Hi, I'm using istream_iterator to read input from standard i/p and writing it to standard o/p using ostream_iterator. I expected it to print the input to the console when I hit enter and then exit but it loops for next input after printing and so on. [code=c++] #include <iostream> #include … |
| | how to make disable for 'task manager' when i press Ctrl+Alt+Del (in c#)? pls could you help me my all fri. very appreciate your help :)  |
| | I ve managed to get this far on my first C# app. The problem is when I am adding files and creating a sub directory to a already existing folder it works but when I re-do the action it won't create a new sub directory as the previous one, as …  |
| | I need to create a C++ program, that one could get a list of suggestions when he's typing. for example: when we type the letter 'A', a list of words that start with the letter A should display. then when we type another letter 'P', the words should filter and … |
| | Hi, I'm just starting my way in C# and I have this question/problem: I've created a "Windows form" project with several forms, where Form1 is the main form and it is also has a statusStrip control. I've managed to change the text in it with a method in Form1, but … |
| | How to change this applet to swing? [CODE]import java.applet.Applet; import java.awt.*; import java.io.PrintStream; public class Hounds extends Applet { public String getAppletInfo() { return "Hare and Hounds"; } public String[][] getParameterInfo() { return parameterInfo; } public void init() { String s = getParameter("bgColor"); try { BG_COLOR = s != null … |
| | Ok well my assignment is to write a program to gives me the total resistance in a circuit. The user is prompted for the resistance type and resistor value such as <1 200> 1 meaning in series, and 200 being the value of the resistor. When the user imputs -1 … |
 | Hi All, I am new to this particular forum because I will like to start working with ASP.NET (it's required in my job) but I haven't the faintest idea anything pertaining ASP.NET. I hear things like Configuring IIS and Visual Studio...I was told that this is for a web-based application...could … |
| | hi, i need validate dinamic table javascript before i insert data do db, i m new here. please help me. here is code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Untitled Document</title> </head> </script> <script type="text/javascript"> /*< |
| | Hi, I have a strange kind of problem. I never faced it nither heard about it. All controls are disappeared from Design mode.:'( [COLOR="Red"]Form.Designer.cs [/COLOR]is having complete code of control initialization but there is no control in design mode... :confused: I tried to add new controls with same name, it … |
| | Does openable get ignored? if not what does it do? [CODE] function openSomething(openable $obj) { $obj->open(); }[/CODE] openable is a class btw. taken from a book. |
| | Hello All, This is my first post on here. I am new to javascript and I have a problem. how can i 1. Have a button that adds a new row of cells to a table 2. In these cells there are input boxes/check boxes/dropdown list/ radioboxes and textarea. 3. … |
| | How do i split a string word by word and store each word into a hashtable? please help Thanks, Saula  |
| | hello guys... I'm new here... I got some problem with my action script code. I'm trying to connect the flash file to MySQL database. All syntax seems good and I think the algorithm is fine too. but, when I run the .fla file and i press the button, i got … |
 | Please help me with this bug. I have python 3.0 and I was using pygame and for some reason it isn't reconizing [CODE]windowSurface[/CODE] here Is the code Im having problems with and thanks in advance. [CODE]import pygame, sys, random from pygame.locals import * #*******************************************SETUPVAR************************************************** BLACK = (0, 0, 0) WHITE … |
| | i have a random data selected from database to the .aspx form example: 1 Hello 1 2 World 2 Nice 1 3 Meet 2 You 2 and i want to export it to excel using "export to excel" button so that it became like this [URL="http://imgur.com/BDblk.jpg"]http://imgur.com/BDblk.jpg[/URL] |
| | hey whatzzzup guys??? i just want to know if this c++ programming language is hard co'z my clasmates are keep on complaining abort that hehe |
| | Hello, I am trying to write a simple program which listens to some data on network and writes to a file. I decided to use mmapped files because the data is very large (magnitude of 3-5 Gigs) and very fast. so as expected, i put the data in queue and … |
 | please help me to get the month only from system. which mean the program dont need to display time , day and also year. how to do with it? i only know to display date. urgent, assignment needed. thanks alot first. |
| | [CODE] package com.ibm.compbio; public abstract class DynamicProgramming { private Cell prevCell; private int score; private int row; private int col; protected String sequence1; protected String sequence2; protected Cell[][] scoreTable; protected boolean tableIsFilledIn; protected boolean isInitialized; public Cell(int row, int col) { this.row = row; this.col = col; } /** * … |
| | Hello, I have tables two tables, the "book" and the "author", a book can have many authors and vice versa, so there is an intermediate table called "book_author" with two columns as foreign key for those two primary keys book_author book_id author_id I'm trying to edit the book details and … |
| | I have this sequence in the text file >sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG HGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFE TMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQD QYGEPPSQRVMLGDERHGARESFLD I want to split this into list as [[COLOR="Red"]'[/COLOR]>sp|P20905|5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster GN=5-HT7 PE=2 SV=1][COLOR="Red"]'[/COLOR],[COLOR="Red"]'[/COLOR]MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLV EGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIV SYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGN VLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVS FDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLI LGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQ THLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAG … |
| | Is there a way to be able to create a new database when a company signs up to my site, and be able to use that database when he/she logs in, so for example if company A logs in he uses CompanyA database and if company B logs in he … |
| | Hello Everybody I am facing some problems while processing a file containing a several lines like this : 1 1134177124.U.0 1134177124.+.613 1134177163.+.2234 1134208365.D 1134520916.U.0 I need to arrange it like this: 1 1134177124 U 0 1 1134177124 + 613 1 1134177163 + 2234 1 1134208365 D 1 1134520916 U 0 … |
| | Hello all, I've had some java experience and looking at my uni units next semester, 1 involves using C, so I decided to start coding C :p. Is there anything wrong with the program structure below? I think there is also some code duplication in there also. [CODE]#include <stdio.h> /* … |
| | I try for uploading file on web server as images of video files with File Uploader Control in asp dot net 2.0. it's ok when we are uploading filea on local machine but on web server it's not work properly. Message thrown Path is Access Denied Please Reply.. |
| | hi, Wen i give the submit button in my aspx page ,the datas is updating in sql,but the page refreshes with the old data,it should be clear in the corresponding fields. pl.guide me. |
| | [CODE]package ATM; // ATM.java import javax.swing.*; public class ATM { private boolean userAuthenticated; // user authentication private int currentAccountNumber; // current account number private Screen screen; // JOptionPane (pop-up(s)) private CashDispenser cashDispenser; // virtual cash dispenser private DepositSlot depositSlot; // virtual deposit slot private BankDatabase bankDatabase; // account database private … |
| | Is there a way to programmatically set the insert point in a multiline richTextbox? Example: I have a (almost) free format message where the reciever is expected to enter his own information at certain points (marked with a special char-sequence), before the message is processed further. A richTextbox.Find will find … |
| | I have recently converted my old project based on C#.NET to my new V.Studio 2010, the project was first created using .NET framework 2.0. In my designer mode within VS2010, all combo boxes, buttons etc. look new (like windows xp button/vista/7 application buttons). however, whenever i debug or even release … |
| | hi all, i am working on online food ordering project. restaurant create zones (circles based on miles as radies) to delivery the food. comapines registerd for food ordering. the company emplyees select there company we must display the restaurnt (Which are contaning this company in there zones). any idea please … |
| | Hi Guys i am trying to insert xml file in database but i am getting this error text/xmldecl not at the beginning of input.Can anyone tell me how to fix this. thanks |
The End.