7,943 Topics
![]() | |
I have started working for a new site last month. Its main keyword for the home page is indexed once, now its not in the SERP. Can anyone here help me to re index my site for that keyword. | |
hi, Just how important are the meta tags in SEO,or are they overated?could your keywords being in the domain,title and appearing 3 or 4 times in the homepage's article do a good enough job for SEO in a low competition niche? Please give your ideas and suggestions on this Thanks … | |
We just started a site zoponline.com it's been up for over a month, I added it to yahoos webmaster tools and verified the site but it has not gotten spidered yet. When I log into webmaster tools I see keywords "domain name, values, No. 1, ICANN-accredited, accredited domain name registrar, … | |
hi, I am working on a text proccessing project, actually related to protein sequences. I want to list occurrences of a search term with the hit positions. I tried the following, but it only gives it for the first hit. [CODE] text = 'MSKSASPKEPEQLRKLFIGGLSFETTDESLRSAHFESSSYGSAGRRF' index = text.find('SA') print index [/CODE] … | |
I have seen many people ask about the importance of SEO. I would like to share one article about it - www buzzle com/articles/seo-importance-in-business html Give me reviews about it. | |
Am completing a website and can't get the final piece to work which is the search engine. Have tried implementing Google's OnTheFly script which works up pop up a new window but only puts out "The resource you have requested could not be found." each and everytime. This was the … | |
Hi, I want to search the log file for a string and extract all data until the end of that line where the search string is found. For example: A line in the file reads like below: [28/04/2010 11:17:53 GMT]PositionPoolCalculation.java(339):getPosCalculation[INFO]BUNP: B123456:1234567:ABCD ANP: B123456:1234567:ABCD:2 post LCN: DESabcdefgh I want to search … | |
I think you can get more links by submitting to ezine directories. Wouldn't you want to get your clients more links? | |
Hi, I want to write a script which will search the net based on a few parameters. They are: 1) Find sites which high pr. 2) Sites should have the feature to allow users to register. I know very basic php and I was wondering how I should go about … | |
Google offer a free "key word" generator that you can locate by search. [url]https://adwords.google.com/select/KeywordToolExternal[/url] Here you can organically find what words are of value and discount the others that are not. I use this tool to rank all of my websites and it is all free. All of my blogs … | |
As far as I understood it... When Google is to rank a page on a website, it considers the content on this specific page (and backlinks and so on...) and counts the keywords. So, page X would rank for Xs keywords while page Y for Ys, while the landing page … | |
Yesterday Google updated PageRank. What did you get from this update? | |
I am not really familiar with the whole [B]SEO[/B] process but I recently hired someone at <snip> to do the whole process for me. The person there made me know that it is not smart to include a lot of my content in my [B]Javascript[/B] files as they are not … | |
Does anyone know or have any experience with Google Sites in Googles searches? Do their spiders like when their name is in the domain? | |
[ATTACH=right]14585[/ATTACH]Google took an interesting step this week when it [URL="http://googlenexusoneboard.blogspot.com/2010/04/update-on-nexus-one-partnerships.html"]announced on its Nexus One blog[/URL] that customers who want to use the Verizon network might be more interested in the [URL="http://phones.verizonwireless.com/htc/incredible/"]HTC Droid Incredible[/URL] instead of its own Nexus One. I've never hidden my disdain for the Google Nexus One strategy … | |
I have tried everything. I went with phpbb over the vb, just because of server issues. I use SEO, feeds, have exchanged posts with other boards, have filed out the Google info for Webmasters, submitted the url, handed out flyers locally, etc.... and yet I can't seem to build any … | |
Hi friends, Pleases suggest me my product pages URL not indexing on Google search page so what can i do for this trouble. | |
Developers Brad Lassey, Alex Pakhotin, Vladimir Vukićević and Michael Wu this week unveiled what they're calling a pre-alpha version of the Fennec browser, better known as Firefox for Google's Android mobile operating system. You can [url=http://bit.ly/fennec-android]download the code[/url], which as of last week had been tested only on Motorola Droid … | |
Since the IPad will only operate using Safari and wont support Flash, do you think you will optimize your site to become iPad friendly? | |
[ATTACH=right]14667[/ATTACH]I've often discussed in this space, [URL="http://www.daniweb.com/news/story255079.html"]the ongoing battle[/URL] among the technology titans--that constant struggle to find the missing link to control the computing world. This week, HP made its move when [URL="http://www.engadget.com/2010/04/28/hp-buys-palm/"]it purchased Palm for $1.2 billion[/URL]. On first blush, it looks like an incredibly stupid step, overpaying for … | |
Hello, I learned from this forum that posting my websites, web pages, blog articles to social bookmarking sites and they really helped me in SEO. I got indexed on new pages or article blogs in just a weeks or even days. I don't post to popular social bookmarking sites like … | |
| |
What's Apple up to now? Yesterday it became public that the company had acquired [url=http://siri.com/]Siri[/url], whose sole purpose in life appears to be to make [url=http://siri.com/about/]Siri[/url], a free iPhone app that helps you find things and make plans. To [url=http://www.youtube.com/watch?v=MpjpVAB06O4&feature=player_embedded]watch Siri in action[/url], it does look pretty useful. But why … | |
Hi friends, I have a website which is ranking top on most of the keywords and PR is also good. As we are going to change it on joomla so for keep the site performance same say keywords ranking, PR so what should i do for it. | |
Hi!! All!! Myself Scott spinella!! I have my social networking website and I want targeted traffic for it..is there any way to get that.. | |
Hi Friends, As i have ecommerce website and i have added code at the payment gateway to track the ecommerce record but still it is not showing anything. As we have third party payment gateway so can anyone let me know the procedure to track ecommerce record on google analytics. … | |
I am trying to search data in database at runtime.... when a user put the license no in the text box and press button this is my query but it is not working, for every search it is showing first record of the database...... Set rd = New Recordset rd.Open … | |
Really? What were you doing that violated their TOS? I know it's still possible because there ARE seo's that are using illegal methods... heard about one the other day where half of the guy's homepage was being shown at the top of google before his competitor made a call to … | |
[URL="http://www.nokia.com"]Nokia[/URL]'s decision to back the [URL="http://www.symbian.org"]Symbian[/URL] operating system with its new [URL="http://europe.nokia.com/find-products/devices/nokia-n8"]N8[/URL] smartphone, which we can expect to see in Q3, could prove more important that you'd have thought initially. There are a number of reasons for this. First, it's the first phone based on the system since the code … | |
OK I have a question regarding back links on your own site. I have a free business advertising forum which I have recently launched, and I am trying to get my PR up. However my signature on this forum has a link pointing back to this same forum. Obviously as … | |
does google see my blog links as external or internal my blog domain news. website .com ? | |
As I understand it, Google can't read flash and Google gives higher weight to keywords and phrases that are nearer the top of the page. (Or have I got it wrong) So, if I am putting a flash slideshow on a homepage, does it matter if this is positioned higher … | |
Hi Friends, Google now has stopped censoring internet search results for chinese users by redirecting them from Google.cn to uncensored Google website in Hong Kong. This move left chinese authorities red faced. Google also planning to leave china by April 10. Comment on it... | |
Can anyone help me fix this problem I have with my code. I am supposed to be writing a Binary Insertion Sort method that calls a binary search method. I have code that is working for in order integers, when tested on reverse order integers it works except it places … | |
if anyone knows, how long spiders/googlebot/adsensebot crawling on a single page of a web ? 3 second ? 10 sec ? 15sec? 30sec ? or maybe 60sec? or it's depending on how many content/words from the page? i specific the question like: how long the spider crawling on a single … | |
I have a big problem with keywords. On my WebMastersTools account shows how the main keywords in the words of the dollar, peso, real, etc. .. I am using WP e-Commerce plugin, but nowhere in the text are used words as dollar, pound, etc.. Some time ago I used the … | |
Does Google's decision on China issue, will affect online marketing of China? | |
reciprocal URL means with which site owners request link exchange | |
Hi Everybody, We have a website developed and hosted in one server. We now wish to switch over to Zen Cart and also want the host server to be changed. It is a Shopping Cart website. By doing this whether our page and keyword rankings would suffer a major blow. … | |
I want to compare web map serving tools for response time when serving a variety of maps. Can you direct me to a free or if not proprietary tool to use for the tool comparison. | |
this topicis about get some solution for my web site hosting. I have done a little research about it. Here is what I have found justhost.com as paid solution or host1free.com as free web hosting solution any reviews about those companies? Here is my question to you: 1. What is … | |
Hello friends, After submitting my websites to social bookmarking sites for a few months, I have gained some experiences about popular and not-too-popular social bookmarking sites. Popular social bookmarking sites are not better than new social bookmarking sites. Why? When I submit one link to a popular one like digg.com, … | |
Hello Friends, I am experiencing the problem with Yahoo explorer authentications that suddenly Yahoo site explorer is not showing my website authenticated. At present it is showing failed status. But in past it was authenticated… Please give your suggestions. Thank you. | |
Hello Friends I checked the number of my backlinks using an online tool. First day the number was 384. The next day when I checked it was 163. Again on the third day it showed 384. What could be the possible reason for this? Thanks | |
Can we use blogs in google webmasters tools? ^^^ This is my question? | |
My client recent launch a German website from a German based hosting service provider. Client want to rank that website in Google.de i,e German version of Google website. What step should I take to rank in Google.de .It is already listed in Google and Yahoo local directory. | |
Hi all, I want to know about video blog and the problem is that Is it a good idea to place a video on a blog to make your blog post effective. And the reason behind this only to raise traffic to blog. Need guidance in this regard. With Regards | |
Hey Everbody, Iam quite new to web development. I have this issue to design a search engine and I cant figure out where to start from.Following is the problem statement 1.Users access our website and send a request. For each request, . In response to each query, the 3rd party … | |
Are web properties 2.0 sites ignored by Google? Sometimes, back creating accounts on web properties 2.0 sites and posting unique articles on those sites and get backlinks - Works well and this approach helps to get quicker SERP in google. But nowadays, It does not. One of my SEO friend … | |
Hi, Finally google updated site PR and I am glad to found that my site PR increased from 0 to 2 in 2 months work... please share your site PR improvement after PR update. |
The End.